Peptides

Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.

Read more

Subcategories of "Peptides"

Oligopeptides

Peptide Synthesis

Products of "Peptides"

20
- 50
- 100
- 200

products per page. 31284 products on this category.

Brand	Product data	Purity	Price range	Estimated delivery
	H-THLAPYSDEL^R-OH REF: 3D-PP44382	- - -	To inquire	Wed 11 Dec 24
	TAMRA-QKRPSQRSKYL-OH REF: 3D-PP44949	- - -	To inquire	Wed 11 Dec 24
	H-GNLLINIR^-OH REF: 3D-PP48679	- - -	To inquire	Wed 11 Dec 24
	H-FESSAAKLKRKYWWK^NLK^-OH REF: 3D-PP49476	- - -	To inquire	Wed 11 Dec 24
	H-ALLPAVPSL^-OH REF: 3D-PP41481	- - -	To inquire	Wed 11 Dec 24
	H-VLDGLDVLL^-OH REF: 3D-PP48352	- - -	To inquire	Wed 11 Dec 24
	H-GAL^^QNIIPASTGAAK-OH REF: 3D-PP46928	- - -	To inquire	Wed 11 Dec 24
	H-ADFLEQPVLGFVR^^-OH REF: 3D-PP46398	- - -	To inquire	Wed 11 Dec 24
	H-ESTLHLVLR^-OH REF: 3D-PP41919	- - -	To inquire	Wed 11 Dec 24
	H-AEEDEILNR^-OH REF: 3D-PP41525	- - -	To inquire	Wed 11 Dec 24
	Ac-QVYSLIRPNENPAHK-OH REF: 3D-PP43628	- - -	To inquire	Wed 11 Dec 24
	H-QYIK^ANSK^FIGITEL-OH REF: 3D-PP40737	- - -	To inquire	Wed 11 Dec 24
	Wang Resin (200-400 mesh) 1% DVB REF: 3D-RWN-1398-PI	Min. 95%	136.00 €~357.00 €	Wed 11 Dec 24
	V14 Peptide REF: 3D-PP50836	- - -	To inquire	Wed 11 Dec 24
	Ac-AGRSL-NH2 REF: 3D-PP43875	- - -	To inquire	Wed 11 Dec 24
	H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH REF: 3D-PP40151	- - -	To inquire	Wed 11 Dec 24
	proFIX18 REF: 3D-PP49027	- - -	To inquire	Wed 11 Dec 24
	H-TAVEQAAAELGDTGR^-OH REF: 3D-PP40131	- - -	To inquire	Wed 11 Dec 24
	Glucagon-Like Peptide I (7-36), amide, human REF: 3D-PP50623CAS: 107444-51-9	- - -	To inquire	Wed 11 Dec 24
	LCBiot-KKRYDREFLLGF-OH REF: 3D-PP43509	- - -	To inquire	Wed 11 Dec 24

discount label

H-THLAPYSDEL^R-OH

H-THLAPYSDEL^R-OH

Peptide H-THLAPYSDEL^R-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP44382

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

TAMRA-QKRPSQRSKYL-OH

TAMRA-QKRPSQRSKYL-OH

Peptide TAMRA-QKRPSQRSKYL-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP44949

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

H-GNLLINIR^-OH

Peptide H-GNLLINIR^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP48679

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

H-FESSAAKLKRKYWWK^NLK^-OH

H-FESSAAKLKRKYWWK^NLK^-OH

Peptide H-FESSAAKLKRKYWWK^NLK^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP49476

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

H-ALLPAVPSL^-OH

H-ALLPAVPSL^-OH

Peptide H-ALLPAVPSL^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP41481

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

H-VLDGLDVLL^-OH

H-VLDGLDVLL^-OH

Peptide H-VLDGLDVLL^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP48352

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

H-GAL^^QNIIPASTGAAK-OH

H-GAL^^QNIIPASTGAAK-OH

Peptide H-GAL^^QNIIPASTGAAK-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP46928

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

H-ADFLEQPVLGFVR^^-OH

H-ADFLEQPVLGFVR^^-OH

Peptide H-ADFLEQPVLGFVR^^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP46398

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

H-ESTLHLVLR^-OH

H-ESTLHLVLR^-OH

Peptide H-ESTLHLVLR^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP41919

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

H-AEEDEILNR^-OH

H-AEEDEILNR^-OH

Peptide H-AEEDEILNR^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP41525

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

Ac-QVYSLIRPNENPAHK-OH

Ac-QVYSLIRPNENPAHK-OH

Peptide Ac-QVYSLIRPNENPAHK-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP43628

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

H-QYIK^ANSK^FIGITEL-OH

H-QYIK^ANSK^FIGITEL-OH

Peptide H-QYIK^ANSK^FIGITEL-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP40737

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

Wang Resin (200-400 mesh) 1% DVB

Wang Resin (200-400 mesh) 1% DVB

Wang Resin is a resin for peptide synthesis with a high loading capacity. Wang Resin …

Purity:

Min. 95%

Ref: 3D-RWN-1398-PI

5g		136.00 €
25g		357.00 €

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

V14 Peptide

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Molecular weight:

1,356.5 g/mol

Ref: 3D-PP50836

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

Ac-AGRSL-NH2

Peptide Ac-AGRSL-NH2 is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP43875

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH

H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH

Peptide H-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL^M^VGGV^V^IA-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP40151

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

proFIX18

Peptide proFIX18 is a Research Peptide with significant interest within the field academic and medical …

Formula:

C₉₅H₁₅₇N₃₁O₂₇

Molecular weight:

2,165.5 g/mol

Ref: 3D-PP49027

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

H-TAVEQAAAELGDTGR^-OH

H-TAVEQAAAELGDTGR^-OH

Peptide H-TAVEQAAAELGDTGR^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP40131

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

Glucagon-Like Peptide I (7-36), amide, human

Glucagon-Like Peptide I (7-36), amide, human

CAS:107444-51-9

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Formula:

C₁₄₉H₂₂₆N₄₀O₄₅

Molecular weight:

3,297.7 g/mol

Ref: 3D-PP50623

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

discount label

LCBiot-KKRYDREFLLGF-OH

LCBiot-KKRYDREFLLGF-OH

Peptide LCBiot-KKRYDREFLLGF-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP43509

Undefined size To inquire

Estimated delivery in United States, on Wednesday 11 Dec 2024

Welcome to CymitQuimica!

We use cookies to enhance your visit. We do not include advertising.

Please see our Cookies Policy for more details or adjust your preferences in "Settings".

SettingsHide settings