Product correctly added to cart.

No image
No image

Peptides

Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.

Read more

Subcategories of "Peptides"

Products of "Peptides"

Sort by


See more categories

This search does not contain any category.

products per page. 31285 products on this category.

discount label

H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH


Ref: 3D-PP47702

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

H-SDAPIGK^-OH


Ref: 3D-PP47385

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

H-FIAGL^IAIV-OH


Ref: 3D-PP42323

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

H-MADDQGRGRRRPLNEDC-NH2


Ref: 3D-PP48835

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

Hemoglobin β chain [133-146]


Ref: 3D-PP50835

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

H-NGFYPATR^-OH


Ref: 3D-PP41115

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

Biot-ARARARAR-OH


Ref: 3D-PP43837

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

H-LSTSEIASHLPTK^^-OH


Ref: 3D-PP43956

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

5FAM-HQSYVDPWMLDH-OH


Ref: 3D-PP46964

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

H-KLPFQR^-OH


Ref: 3D-PP41393

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

H-VGQEIEVRPGIVSK^-OH


Ref: 3D-PP41649

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

S961 TFA


Ref: 3D-PP50164

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

H-TPAYYPNAGLIK^-OH


Ref: 3D-PP49454

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

LCBiot-YGRKKRRQRRRGGVGNDFFINHETTGFATEW-OH


Ref: 3D-PP49060

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

H-TELLPGDRDNLAIQTR^-OH


Ref: 3D-PP40601

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

H-CPSSHSSLTERHKILHRLLQEGSPS-NH2


Ref: 3D-PP46069

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

H-ASHLGLAR^-OH


Ref: 3D-PP40475

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

H-VVV^GADGVGK^-OH


Ref: 3D-PP48023

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

HIV - 1 MN ENV - 205


Ref: 3D-PP50078

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
discount label

H-GSFPWQA^K^-OH


Ref: 3D-PP42773

Undefined sizeTo inquire
Estimated delivery in United States, on Friday 13 Dec 2024
Welcome to CymitQuimica!We use cookies to enhance your visit. We do not include advertising.

Please see our Cookies Policy for more details or adjust your preferences in "Settings".