Inhibidores
Los inhibidores son moléculas que se unen a enzimas, receptores u otras proteínas para reducir o bloquear su actividad biológica. Estos compuestos se utilizan ampliamente en la investigación para estudiar vías biológicas, comprender los mecanismos de las enfermedades y desarrollar fármacos terapéuticos. Los inhibidores desempeñan un papel crucial en el tratamiento de diversas enfermedades, incluyendo el cáncer, las enfermedades cardiovasculares y las infecciones. En CymitQuimica, ofrecemos una amplia gama de inhibidores de alta calidad para apoyar su investigación en bioquímica, biología celular y desarrollo farmacéutico.
Subcategorías de "Inhibidores"
- Angiogénesis(2.687 productos)
- Apoptosis(6.097 productos)
- Ciclo celular / Checkpoint(4.691 productos)
- Cromatina / Epigenética(2.376 productos)
- Señalización citoesquelética(1.472 productos)
- Daño al ADN / Reparación del ADN(2.921 productos)
- Endocrinología / Hormonas(3.611 productos)
- Enzima(3.655 productos)
- GPCR / proteína G(8.755 productos)
- Inmunología e inflamación(3.765 productos)
- Virus de la gripe(298 productos)
- Señalización JAK / STAT(407 productos)
- Señalización MAPK(1.230 productos)
- Transportador de membrana / canal de iones(2.947 productos)
- Metabolismo(9.940 productos)
- Microbiología / Virología(7.347 productos)
- Neurociencia(10.240 productos)
- Otros inhibidores(36.533 productos)
- Reducción de oxidación(43 productos)
- Señalización PI3K / Akt / mTOR(1.437 productos)
- Proteasas / Proteasoma(1.675 productos)
- Células madre y Derivados(830 productos)
- Tirosina quinasa / adaptadores(2.028 productos)
- Ubiquitinación(1.682 productos)
Mostrar 16 subcategorías más
Se han encontrado 66582 productos de "Inhibidores"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Acid-PEG4-mono-methyl ester
CAS:Acid-PEG4-mono-methyl ester, a PEG- and Alkyl/ether-based PROTAC linker, can be employed for PROTAC synthesis[1].Fórmula:C13H24O8Pureza:98%Forma y color:SolidPeso molecular:308.32CRX-526
CAS:<p>CRX-526, a TLR4 antagonist, protects against advanced diabetic nephropathy.</p>Fórmula:C69H127N2O19PPureza:98%Forma y color:SolidPeso molecular:1319.72Benzylamine hydrochloride
CAS:<p>Benzylamine hydrochloride, made of benzylamine and hydrochloric acid, is used to treat motion sickness and ascariasis, with antiemesis properties.</p>Fórmula:C7H10ClNPureza:95.94%Forma y color:White Crystal Or Crystalline PowderPeso molecular:143.61N-Methyltaxol C
CAS:N-methyltaxol C and paclitaxel boost heart muscle contractility but may cause arrhythmias and decrease coronary flow and heart pressure.Fórmula:C47H59NO14Pureza:98%Forma y color:SolidPeso molecular:861.982(16R)-Dihydrositsirikine
CAS:(16R)-Dihydrositsirikine is a natural product for research related to life sciences. The catalog number is TN2652 and the CAS number is 6519-26-2.Fórmula:C21H28N2O3Pureza:98%Forma y color:SolidPeso molecular:356.466Biotin-PEG4-Picolyl azide
CAS:<p>Biotin-PEG4-Picolyl azide is a PEG-based PROTAC linker that can be used to synthesize PROTAC molecules.</p>Fórmula:C27H42N8O7SPureza:97.71%Forma y color:SolidPeso molecular:622.74Litseglutine B
CAS:Litseglutine B is a natural product for research related to life sciences. The catalog number is TN4444 and the CAS number is 25368-01-8.Fórmula:C20H23NO4Pureza:98%Forma y color:SolidPeso molecular:341.4Exendin-4 peptide derivative
<p>Exendin-4 derivative FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS linked to GLP-1/glucagon agonism.</p>Pureza:98%Forma y color:SolidPeso molecular:3692.15N-(Azido-PEG3)-N-bis(PEG3-acid)
CAS:Azido-PEG3-linked bis(PEG3-acid) useful for PROTACs, aiding targeted protein degradation.Fórmula:C26H50N4O13Pureza:98%Forma y color:SolidPeso molecular:626.69AE-3763
CAS:AE-3763 is a peptide-based human neutrophil elastase inhibitor (IC50: 29 nM).Fórmula:C23H34F3N5O7Pureza:98%Forma y color:SolidPeso molecular:549.54Cefquinome
CAS:<p>Cefquinome is a cephem antibiotic that inhibits Enterobacteriaceae (family [1]).</p>Fórmula:C23H24N6O5S2Pureza:98%Forma y color:SolidPeso molecular:528.6Xenin-8
CAS:<p>neurotensin-like peptide that modulate pancreatic insulin and glucagon secretion/effects</p>Fórmula:C51H79N15O9Pureza:98%Forma y color:SolidPeso molecular:1046.27Capoamycin
CAS:<p>Capoamycin is an insotatracine antibiotic investigated for anti tumor properties.</p>Fórmula:C35H38O10Pureza:98%Forma y color:SolidPeso molecular:618.679N3-PEG2-C2-PFP ester
CAS:The N3-PEG2-C2-PFP ester, a nonclaevable 2-unit polyethylene glycol (PEG) linker, is commonly employed in the synthesis of antibody-drug conjugates (ADCs).Fórmula:C13H12F5N3O4Pureza:98%Forma y color:SolidPeso molecular:369.24Ervamycine
CAS:11-Methoxytabersonine (Ervamycine) inhibits five cancer cell lines; IC50 similar to cisplatin, vinorelbine.Fórmula:C22H26N2O3Pureza:98%Forma y color:SolidPeso molecular:366.45Nummularine B
CAS:Nummularine B, a cyclopeptide alkaloid, inhibits PEDV replication with antiviral properties.Fórmula:C32H41N5O6Pureza:98%Forma y color:SolidPeso molecular:591.709Abiesadine N
CAS:<p>Abiesadine N is a natural product for research related to life sciences. The catalog number is TN3333 and the CAS number is 1159913-80-0.</p>Fórmula:C21H30O3Pureza:98%Forma y color:SolidPeso molecular:330.46Laidlomycin propionate potassium
CAS:<p>Laidlomycin propionate potassium is a growth stimulant (Veterinary).</p>Fórmula:C40H65KO13Forma y color:SolidPeso molecular:793.03Pancixanthone A
CAS:<p>Pancixanthone A shows potential as an antimalarial and antileishmanial agent against L. mexicana and L. infantum.</p>Fórmula:C18H16O5Pureza:98%Forma y color:SolidPeso molecular:312.32Dihydroguaiaretic acid
CAS:meso-Dihydroguaiaretic acid is an LXR-α antagonist, it inhibits hepatic lipid accumulation by activating AMP-activated protein kinase in human HepG2 cells.Fórmula:C20H26O4Pureza:98%Forma y color:SolidPeso molecular:330.42
