
Aminoácidos (AA)
Los aminoácidos (AAs) son los componentes fundamentales de las proteínas y desempeñan un papel crucial en diversos procesos biológicos. Estos compuestos orgánicos son esenciales para la síntesis de proteínas, las rutas metabólicas y la señalización celular. En esta categoría, encontrará una gama completa de aminoácidos, incluyendo formas esenciales, no esenciales y modificadas, que son vitales para la investigación en bioquímica, biología molecular y ciencias de la nutrición. En CymitQuimica, ofrecemos aminoácidos de alta calidad para apoyar sus necesidades de investigación y desarrollo, asegurando precisión y fiabilidad en sus resultados experimentales.
Subcategorías de "Aminoácidos (AA)"
- Derivados de aminoácidos(3.957 productos)
- Aminoácidos y compuestos relacionados con aminoácidos(3.472 productos)
- Aminoácidos con oxígeno o azufre(168 productos)
- Aminoácidos protegidos con Boc(351 productos)
- Aminoácidos protegidos con Fmoc(1.710 productos)
Se han encontrado 38265 productos de "Aminoácidos (AA)"
Ordenar por
Pureza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Boc-Lys(Z)-Lys(Z)-Lys(Z)-Lys(Z)-OBzl
CAS:Please enquire for more information about Boc-Lys(Z)-Lys(Z)-Lys(Z)-Lys(Z)-OBzl including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C68H88N8O15Pureza:Min. 95%Peso molecular:1,257.47 g/molNeurotensin (9-13)
CAS:<p>Neurotensin (NT) is a peptide hormone that belongs to the family of amides and is found in the stomach, small intestine, and central nervous system. NT is an agonist of the neurotensin receptor and binds to allosteric binding sites on the receptor. Neurotensin (NT) is modified by proteolysis, which may be due to its acidic residue at position 9. This modification leads to increased affinity for the neurotensin receptor binding site. The pharmacokinetic properties of NT are not well-understood as it has been shown to have both high lipophilicity and low plasma protein binding rates. Neurotensin (NT) receptors have been shown to be G protein coupled receptors with different subtypes, such as NT1, NT2A, NT2B, and NT3.</p>Fórmula:C32H52N8O7Pureza:Min. 95%Peso molecular:660.81 g/molH-Pro-Phe-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-His-Leu-OH
CAS:<p>Please enquire for more information about H-Pro-Phe-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-His-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C83H125N23O19Pureza:Min. 95%Peso molecular:1,749.02 g/molH-Cit-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Cit-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C16H20N4O4Pureza:Min. 95%Peso molecular:332.35 g/mol(Des-Thr5)-Glucagon trifluoroacetate salt
CAS:<p>Please enquire for more information about (Des-Thr5)-Glucagon trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C149H218N42O47SPureza:Min. 95%Peso molecular:3,381.65 g/molMethylenedi-p-phenyl diisocyanate
CAS:<p>Methylenedi-p-phenyl diisocyanate (MDI) is a glycol ether, which is a potent inducer of allergic reactions. It can be found in polyurethane foam insulation and in the production of diphenyl and diisocyanate. MDI has been shown to cause asthma, skin inflammation, and other respiratory problems. MDI is highly toxic to aquatic life and can cause long term effects on fish populations. The toxicity of MDI depends on the concentration and duration of exposure, as well as the species that it is administered to. High concentration exposure for a short period of time will result in death by respiratory failure or cardiac arrest. Longer exposure at lower concentrations may lead to liver, kidney, lung damage or cancerous tumor development.</p>Fórmula:C15H10N2O2Pureza:Min. 95%Peso molecular:250.25 g/molLysozyme C (46-61) (chicken) trifluoroacetate salt
CAS:<p>Lysozyme C (46-61) (chicken) trifluoroacetate salt is a conjugated synthetic peptide that binds to the antigen. It is a reactive molecule with solubilized properties that has been shown to bind to the peptide in binding experiments. This synthetic peptide has been found to be efficacious in transfected murine bone cells and antigen-presenting cells. The binding of Lysozyme C (46-61) (chicken) trifluoroacetate salt to phospholipid membranes may be due to its reactivity with the membrane's hydrophobic surface.</p>Fórmula:C72H116N22O29Pureza:Min. 95%Peso molecular:1,753.82 g/molBoc-Lys(Fmoc)-Leu-Ala-Leu-OH
CAS:<p>Please enquire for more information about Boc-Lys(Fmoc)-Leu-Ala-Leu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C41H59N5O9Pureza:Min. 95%Peso molecular:765.94 g/molMca-Gly-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about Mca-Gly-Lys-Pro-Ile-Leu-Phe-Phe-Arg-Leu-Lys(Dnp)-D-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C85H122N22O19Pureza:Min. 95%Peso molecular:1,756.02 g/molBoc-Arg(Tos)-Merrifield resin (200-400 mesh)
<p>Please enquire for more information about Boc-Arg(Tos)-Merrifield resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Z-Phe-Cit-AMC
CAS:<p>Z-Phe-Cit-AMC is a fluorescent substrate for the enzymes cysteine and peptide aminopeptidases. It has been synthesized by conjugating 7-amino-4-methylcoumarin with L-phenylalanine. The product is useful in assays to measure the activity of these enzymes, which are involved in protein digestion and wound healing. Z-Phe-Cit-AMC can be hydrolyzed by bromelain, ficin, or papain and it can be used as a substrate for enzyme reactions.</p>Fórmula:C33H35N5O7Pureza:Min. 95%Peso molecular:613.66 g/mol(Des-Gly10,D-His2,D-His(Bzl)6,Pro-NHEt 9)-LHRH
CAS:<p>Please enquire for more information about (Des-Gly10,D-His2,D-His(Bzl)6,Pro-NHEt 9)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C66H86N18O12Pureza:Min. 95%Peso molecular:1,323.5 g/molH-β-Ala-Val-OH
CAS:<p>H-beta-Ala-Val-OH is a synthetic amino acid that has been positioned in the beta helix of a crystallographic protein. It has a helical structure with an alpha carbon backbone. The dipeptide is water soluble and dipeptides are found in helices, which are hydrogen bonded to other helices. H-beta-Ala-Val-OH also has supramolecular properties, which means it can form structures on its own that are not dependent on other molecules.</p>Fórmula:C8H16N2O3Pureza:Min. 95%Peso molecular:188.22 g/mol(R)-(+)-2-Methyl-CBS-oxazaborolidine
CAS:<p>(R)-(+)-2-Methyl-CBS-oxazaborolidine is a dpp-iv inhibitor that is a β-unsaturated ketone. It has been shown to inhibit the enzyme histone lysine demethylase, which may be involved in the regulation of bone mass. This compound also has a pharmacokinetic profile that is characterized by high oral bioavailability, low plasma protein binding, and rapid metabolism by liver enzymes. The reaction mechanism for this compound is based on the formation of an enolate carbanion. (R)-(+)-2-Methyl-CBS-oxazaborolidine can be synthesized with high stereoselectivity and yields from reactions with simple starting materials. This synthetic route also has a number of advantages over other methods: it does not require any protecting groups, it does not use toxic solvents such as dichloromethane or chloroform, and it can be performed in anhydrous conditions</p>Fórmula:C18H20BNOPureza:Min. 95%Forma y color:SolidPeso molecular:277.17 g/molBoc-Arg(Tos)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Arg(Tos)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%(D-Trp12,Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (D-Trp12,Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C165H251N49O40S2Pureza:Min. 95%Peso molecular:3,625.2 g/molOctreotide trifluoroacetate salt (Dimer, Parallel) (
<p>Please enquire for more information about Octreotide trifluoroacetate salt (Dimer, Parallel) ( including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C98H132N20O20S4Pureza:Min. 95%Peso molecular:2,038.48 g/molFmoc-p-phenyl-L-phenylalanine
CAS:<p>Fmoc-p-phenyl-L-phenylalanine (FMPP) is a fluorescent probe that can be used to detect and diagnose damage in tissues. It is a small molecule that has been shown to bind to myocytes and cardiac tissues, specifically targeting skeletal and cardiac muscle. FMPP binds to the amino acid phenylalanine, which is found in high concentrations in cardiac tissue. This binding causes an increase in fluorescence, which can be detected by light microscopy or flow cytometry. FMPP has been used to detect damage in heart muscles of mice with dilated cardiomyopathy and also as a probe for myocardial infarctions in humans.</p>Fórmula:C30H25NO4Pureza:Min. 98 Area-%Forma y color:PowderPeso molecular:463.52 g/molAF-16 trifluoroacetate salt
CAS:<p>AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.</p>Fórmula:C71H119N25O25SPureza:Min. 95%Peso molecular:1,754.92 g/molRanalexin
CAS:<p>Ranalexin is a peptide antibiotic that has been isolated from the fungus Penicillium patulum. It is an antimicrobial peptide and has shown antibacterial efficacy against gram-positive bacteria, including methicillin-resistant Staphylococcus aureus and Enterococcus faecalis. Ranalexin binds to bacterial membrane receptors, leading to rapid cell death. The biological properties of ranalexin are still being studied in order to determine its mechanism of action.</p>Fórmula:C97H167N23O22S3Pureza:Min. 95%Peso molecular:2,103.7 g/mol(Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg17)-Amyloid b-Protein (1-42) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C203H312N58O60SPureza:Min. 95%Peso molecular:4,557.07 g/molH-Ala-D-Gln-OH
CAS:<p>Please enquire for more information about H-Ala-D-Gln-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C8H15N3O4Pureza:Min. 95%Peso molecular:217.22 g/molH-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Phe-D-Met-Arg-Phe-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C29H42N8O4SPureza:Min. 95%Peso molecular:598.76 g/mol(R)-N-Glycidylphthalimide
CAS:<p>R-N-Glycidylphthalimide is an enantioselective chiral reagent that is used to produce optically pure alcohols. It has been shown to have antibacterial activity in a number of carboxylic acid derivatives. R-N-Glycidylphthalimide was shown to be a good solvating agent, with the ability to form hydrogen bonds with water molecules and hydroxyl groups on proteins. R-N-Glycidylphthalimide is also useful for the synthesis of chiral amines, including ethylamine and amino acids, which are important in the pharmaceutical industry.</p>Fórmula:C11H9NO3Pureza:Min. 95%Forma y color:White/Off-White SolidPeso molecular:203.19 g/molIGF-I Analog
CAS:<p>Please enquire for more information about IGF-I Analog including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C55H88N14O15S2Pureza:Min. 95%Peso molecular:1,249.5 g/molAc-Val-Arg-Pro-Arg-AMC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Val-Arg-Pro-Arg-AMC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C34H51N11O7•C2HF3O2Pureza:Min. 98 Area-%Forma y color:PowderPeso molecular:839.86 g/molAc-Phe-Lys-OH
CAS:<p>Ac-Phe-Lys-OH is a synthetic peptide that mimics the lysine side chain of L-lysine. It has been shown to be cytotoxic to cancer cells and cardiac cells, with the formation rate of Ac-Phe-Lys-OH being dependent on the concentration of glycolaldehyde. The reaction yield for Ac-Phe-Lys-OH is also dependent on creatine kinase activity. Acetylation of Ac-Phe-Lys-OH reduces its cytotoxicity and increases its solubility in water.</p>Fórmula:C17H25N3O4Pureza:Min. 95%Peso molecular:335.4 g/molN-Methyl-DL-alanine
CAS:<p>N-Methyl-DL-alanine is an amino acid that is also known as d-alanine. It is a precursor for the synthesis of other amino acids such as histidine, methionine, and arginine. N-Methyl-DL-alanine is found in the mitochondria of cells and plays a role in energy metabolism. It has been shown to be taken up by cells through an active transport process and can act as a competitive inhibitor of mitochondrial uptake. At physiological concentrations, N-methyl DL-alanine inhibits fatty acid oxidation by decreasing the activity of carnitine palmitoyltransferase I (CPT I) and enhancing lipid accumulation in the liver. N-Methyl DL-alanine has been shown to inhibit cycloleucin A production by acting as an inhibitor of fatty acid synthase (FAS).</p>Fórmula:C4H9NO2Pureza:Min. 95%Forma y color:White PowderPeso molecular:103.12 g/molSuc-Phe-Leu-Phe-SBzl
CAS:<p>Suc-Phe-Leu-Phe-SBzl is a protease inhibitor that blocks the activity of serine proteases and inhibits protein synthesis. It has been shown to be active against a number of proteases, such as trypsin, chymotrypsin, elastase, and cathepsin G. Suc-Phe-Leu-Phe-SBzl has been reported to inhibit the activity of serine proteases at low concentrations but not at high concentrations. This drug also has a potent effect on cellular organelles such as mitochondria and lysosomes. The enzyme inhibition property of Suc-Phe-Leu-Phe-SBzl is due to its ability to bind strongly to proteins with hydrophobic amino acid residues in their active site.</p>Fórmula:C35H41N3O6SPureza:Min. 95%Peso molecular:631.78 g/molH-Thr(tBu)-NH2·HCl
CAS:<p>Please enquire for more information about H-Thr(tBu)-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C8H18N2O2·HClPureza:Min. 95%Peso molecular:210.7 g/molEGF Receptor (988-993) (phosphorylated) (human)
CAS:<p>Please enquire for more information about EGF Receptor (988-993) (phosphorylated) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C31H46N7O16PPureza:Min. 95%Peso molecular:803.71 g/molBursin (avian)
CAS:<p>Bursin is a vaccine that is used to prevent the infection of avian influenza in chickens. It has been shown to stimulate antibody production and increase the immune response in chickens. Bursin consists of an amino terminal, carboxy terminal, and a peptide sequence that binds to receptors on the surface of cells. Peptides such as bursin are used for sample preparation or expression plasmids in tissue culture experiments. Bursin also has calcium-binding properties and can be used as a histochemical stain for skin cells. The hydroxyl group on the side chain is important for its function.</p>Fórmula:C14H25N7O3Pureza:Min. 95%Peso molecular:339.39 g/mol2-Bromo-3-methylbenzoic acid
CAS:<p>2-Bromo-3-methylbenzoic acid is an alcohol that has been shown to be selective for the stereoselective synthesis of chiral secondary alcohols. It has been used in the reduction of 2-formylphenylboronic acid, yielding a mixture of the two possible diastereomers, and in the reductive elimination of carboxylic acids, which can be used as an alternative to the Baylis-Hillman reaction. The compound also has inhibitory activity against several bacteria, including methicillin resistant Staphylococcus aureus (MRSA) and Mycobacterium tuberculosis. 2-Bromo-3-methylbenzoic acid is photochromic and changes color from yellow to red when exposed to UV light.</p>Fórmula:C8H7BrO2Pureza:Min. 95%Forma y color:PowderPeso molecular:215.04 g/mol1-Boc-4-aminoindole
CAS:<p>Please enquire for more information about 1-Boc-4-aminoindole including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C13H16N2O2Pureza:Min. 95%Peso molecular:232.28 g/molH-Pro-Pro-Gln-OH trifluoroacetate salt
CAS:<p>Please enquire for more information about H-Pro-Pro-Gln-OH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C15H24N4O5Pureza:Min. 95%Peso molecular:340.38 g/molHippuryl-Phe-OH
CAS:<p>Hippuryl-Phe-OH is a soybean trypsin inhibitor that has been shown to have irreversible inhibition of trypsin and other enzymes. It is active at low pH, with a ph optimum of 5.5. Hippuryl-Phe-OH binds irreversibly to the active site of enzymes, thereby preventing them from catalyzing reactions. This irreversible inhibition can be exploited for use in vitro assays as well as biological studies such as cell culture, animal models, and human serum studies.</p>Fórmula:C18H18N2O4Pureza:Min. 95%Peso molecular:326.35 g/mol2-methyl-6-(trifluoromethyl)aniline
CAS:<p>2-Methyl-6-(trifluoromethyl)aniline is a colorless, oily liquid with a sulfurous odor. It is soluble in water and alcohol. The reaction rate of 2-methyl-6-(trifluoromethyl)aniline with sulfoxides is faster than that of benzyl anilines, but slower than that of anilino derivatives. The addition of hydrophobic groups to the 2-methyl-6-(trifluoromethyl)aniline molecule increases the reaction rate. 2-Methyl-6-(trifluoromethyl)aniline can be used as an anesthetic agent because it is a potent inhibitor of nerve conduction in sciatic nerves. It also has been shown to be effective in desulfurizing propylene, which is important for the production of polypropylene plastics and synthetic rubber. 2-Methyl-6-(triflu</p>Fórmula:C8H8F3NPureza:Min. 95%Peso molecular:175.15 g/molFmoc-Trp(Boc)-Thr(Psi(Me,Me)pro)-OH
CAS:<p>Please enquire for more information about Fmoc-Trp(Boc)-Thr(Psi(Me,Me)pro)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C38H41N3O8Pureza:Min. 95%Peso molecular:667.75 g/molFmoc-4-Cpa-4-Cpa-OH
<p>Fmoc-4-Cpa-4-Cpa-OH is a versatile building block that can be used to synthesize complex compounds with interesting biological activity. It is a reagent, speciality chemical, and useful scaffold for research chemicals. Fmoc-4-Cpa-4-Cpa-OH has been used in the synthesis of a number of biologically active compounds and as an intermediate for the synthesis of other chemical compounds.</p>Fórmula:C33H28Cl2N2O5Pureza:Min. 95%Forma y color:PowderPeso molecular:603.49 g/molFmoc-Lys-OH·HCl
CAS:<p>Fmoc-Lys-OH·HCl is an acidic pyrylium that has been shown to be a potent inhibitor of tumor vasculature. It binds to the human serum albumin and inhibits the binding of ligands to the receptor tyrosine kinases, which are involved in brain tumor proliferation. Fmoc-Lys-OH·HCl has also been shown to inhibit the growth of cancer cells by binding to cell membrane receptors and inhibiting protein synthesis. This compound is also isomeric, meaning it can exist in different forms with different properties.</p>Fórmula:C21H24N2O4·HClPureza:Min. 95 Area-%Forma y color:White PowderPeso molecular:404.89 g/molDABCYL-Arg-Gly-Val-Val-Asn-Ala-OH
CAS:<p>Please enquire for more information about DABCYL-Arg-Gly-Val-Val-Asn-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C40H59N13O9Pureza:Min. 95%Peso molecular:865.98 g/molBoc-Ser(Bzl)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Ser(Bzl)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%(Des-His6)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt
<p>Please enquire for more information about (Des-His6)-ACTH (1-24) (human, bovine, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C130H203N37O30SPureza:Min. 95%Peso molecular:2,796.3 g/molFmoc-4-(7-hydroxy-4-coumarinyl)-Abu-OH
CAS:<p>Please enquire for more information about Fmoc-4-(7-hydroxy-4-coumarinyl)-Abu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C28H23NO7Pureza:Min. 95%Peso molecular:485.48 g/molZ-N-Me-D-Ser(tBu)-OH·DCHA
CAS:Producto controlado<p>Please enquire for more information about Z-N-Me-D-Ser(tBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C16H23NO5·C12H23NPureza:Min. 95%Peso molecular:490.68 g/mol(S,S)-2,2'-Isopropylidenebis(4-phenyl-2-oxazoline)
CAS:<p>(S,S)-2,2'-Isopropylidenebis(4-phenyl-2-oxazoline) is an asymmetric ligand that is chiral and has been shown to be useful in the preparation of enantiopure alcohols. The compound has been used as a catalyst to prepare aldehydes and ketones. It also has been used in reactions involving dehydration or alkylation. (S,S)-2,2'-Isopropylidenebis(4-phenyl-2-oxazoline) can be synthesized by reacting molybdenum with an alcohol and adding a base. This reaction produces the desired product with high selectivity, which is due to its chirality.</p>Fórmula:C21H22N2O2Pureza:Min. 95%Forma y color:Colourless Or White To Yellow Solid Or Liquid (May Vary)Peso molecular:334.41 g/mol(5-Bromo-2-methoxyphenyl)acetic acid
CAS:<p>5-Bromo-2-methoxyphenyl)acetic acid (BMPEA) is a hydroxylated derivative of aspartic acid. It has been shown to induce apoptotic cell death in various cell lines, including human lung cells and rat hippocampal cells. BMPEA is synthesized by the solid-phase method and is characterized by a constant structure. It can be used to treat degenerative diseases and other conditions where apoptosis is desirable, such as Alzheimer's disease, Parkinson's disease, amyotrophic lateral sclerosis, retinitis pigmentosa, and Duchenne muscular dystrophy.</p>Fórmula:C9H9BrO3Pureza:Min. 95%Forma y color:PowderPeso molecular:245.07 g/molPre-S2 (1-26)
CAS:<p>Please enquire for more information about Pre-S2 (1-26) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C131H199N39O37SPureza:Min. 95%Peso molecular:2,944.29 g/molDansyl-Tyr-Val-Gly-OH trifluoroacetate salt
CAS:<p>Dansyl-Tyr-Val-Gly-OH trifluoroacetate salt is a glyoxylate analog that can be used as a substrate in the kinetic assays for glyoxalase I. The enzyme catalyses the conversion of this compound to Dansylglyoxal, which can be detected by absorbance at 360 nm. The second order rate constant and acidic pH of the reaction have been determined using biophysical experiments and expressed as a function of substrate concentration. Inactivates papilloma virus, which is the virus that causes genital warts, at low concentrations.</p>Fórmula:C28H34N4O7SPureza:Min. 95%Peso molecular:570.66 g/molFmoc-Arg(Mtr)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Arg(Mtr)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%H-Asp-Arg-OH
CAS:<p>H-Asp-Arg-OH is a histamine releasing factor. Histamine is a neurotransmitter that regulates the release of other neurotransmitters in the brain. It also has been shown to be an important mediator of inflammatory reactions and has been associated with asthma, allergic reactions, and inflammation. H-Asp-Arg-OH can be used as a histological stain for the detection of 8-hydroxyquinoline and its metabolites such as glucuronides in tissues. The distribution pattern of this compound can be visualized using infrared spectroscopy and β-glucuronidase activity can be detected by color change in histochemical reactions.</p>Fórmula:C10H19N5O5Pureza:Min. 95%Peso molecular:289.29 g/molH-D-Leu-bNA·HCl
CAS:<p>Please enquire for more information about H-D-Leu-bNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C16H20N2O·HClPureza:Min. 95%Peso molecular:292.8 g/molH-Ser-AMC hydrochloride salt
CAS:<p>Please enquire for more information about H-Ser-AMC hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C13H14N2O4Pureza:Min. 95%Peso molecular:262.26 g/molLysine(succinyl)-OH
CAS:<p>Lysine(succinyl)-OH, also known as N6-(3-carboxypropanoyl)-L-lysine, is a research chemical that falls under the category of amino acids. It is a derivative of lysine and has been widely used in various research studies. Lysine(succinyl)-OH is commonly used as a substrate for dehydrogenase enzymes and has been found to play a role in metabolic pathways. In addition to its research applications, Lysine(succinyl)-OH has also shown potential benefits for external use. It has been found to have moisturizing properties that can help improve the appearance of dry or damaged cuticles. Its succinyl group enhances its ability to penetrate the skin, providing deep hydration and nourishment. Lysine(succinyl)-OH is encoded by specific genes and expressed in various organisms. Its presence in different biological systems suggests its significance in cellular processes. In addition to its use as a</p>Fórmula:C10H18N2O5Pureza:Min. 95%Forma y color:PowderPeso molecular:246.26 g/molHIV-1 gag Protein p24 (194-210)
CAS:<p>Please enquire for more information about HIV-1 gag Protein p24 (194-210) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C73H126N20O23SPureza:Min. 95%Peso molecular:1,683.97 g/molGlutathione-monoethyl ester (reduced)
CAS:<p>Glutathione-monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH is a polymerase chain reaction (PCR) enhancer that consists of a glutathione monoester and an ethyl ester. Glutathione monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH is used as a cancer therapeutics agent in the treatment of cells with high levels of reactive oxygen species. It also inhibits drug efflux from cells and induces apoptosis in endothelial cells, which can lead to the inhibition of tumor growth. Glutathione monoethyl ester (reduced) H-Glu(Cys-Gly-OEt)-OH has been shown to cause changes in intracytoplasmic sperm and protein thiols in PC12 cells, which may be related to its ability to inhibit cell proliferation.</p>Fórmula:C12H21N3O6SPureza:Min. 95%Peso molecular:335.38 g/molNeuromedin U-8 (porcine) trifluoroacetate salt
CAS:<p>Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn-NH2 trifluoroacetate salt is a molecule that inhibits the action of vasoactive intestinal peptide. It is a peptide hormone that has been shown to be involved in the regulation of bowel function and blood pressure. Neuromedin U-8 (porcine) trifluoroacetate salt H-Tyr-Phe-Leu-Phe-Arg-Pro-Arg-Asn NH2 trifluoroacetate salt has also been shown to inhibit cell proliferation, cancer, and inflammatory bowel disease. Neuromedin U 8 (porcine) trifluoroacetate salt H Tyr Phe Leu Phe Arg Pro Arg Asn NH2 trifluoroacetate salt binds to the receptor for</p>Fórmula:C54H78N16O10Pureza:Min. 95%Peso molecular:1,111.3 g/molInsulin B (22-25)
CAS:<p>Please enquire for more information about Insulin B (22-25) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C26H35N7O5Pureza:Min. 95%Peso molecular:525.6 g/mol1-Oleoyl-3-palmitoyl-rac-glycero-2-phosphoethanolamine
CAS:<p>Please enquire for more information about 1-Oleoyl-3-palmitoyl-rac-glycero-2-phosphoethanolamine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C39H76NO8PPureza:Min. 95%Peso molecular:718 g/molN-α-Fmoc-β-(1-boc-piperidin-4-yl)-dl-alanine
CAS:<p>Please enquire for more information about N-alpha-Fmoc-beta-(1-boc-piperidin-4-yl)-dl-alanine including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C28H34N2O6Pureza:Min. 95%Peso molecular:494.58 g/molFmoc-Met-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Met-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Amyloid P Component (27-38) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about Amyloid P Component (27-38) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C68H107N19O17SPureza:Min. 95%Peso molecular:1,494.76 g/molH-Lys-Leu-Lys-OH triacetate salt
CAS:<p>Please enquire for more information about H-Lys-Leu-Lys-OH triacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C18H37N5O4•3C2H4O2Pureza:Min. 95%Peso molecular:567.67 g/molAtrial Natriuretic Factor (1-29) (chicken)
CAS:<p>Please enquire for more information about Atrial Natriuretic Factor (1-29) (chicken) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C124H211N47O40S5Pureza:Min. 95%Peso molecular:3,160.62 g/molCyclo(-D-Trp-Tyr)
CAS:<p>Cyclo(-D-Trp-Tyr) is a cyclic peptide that is produced by the fungus Microbispora sp. It has been shown to inhibit the growth of Staphylococcus aureus, as well as other bacteria, fungi and cancer cells. Cyclo(-D-Trp-Tyr) binds to the ribosomal RNA in these cells and inhibits protein synthesis. The peptide does not bind to subtilisin or bgc-823, but does bind to lung fibroblasts and leukemia cells.</p>Fórmula:C20H19N3O3Pureza:Min. 95%Peso molecular:349.38 g/molType B Allatostatin
CAS:<p>Allatostatin is a type of allatotropin. Allatotropins are a family of neuropeptides that inhibit the release of other hormones, such as vitellogenin, which is a hormone that stimulates vitellogenesis in insect ovaries. Allatostatin inhibits the release of vitellogenin by binding to the receptor on the egg follicle cells and blocking its action. This drug has been shown to be effective at inhibiting mevalonate production in rat ganglia and is also found in high concentrations in holometabolous insects. It is synthesized from an amide precursor by a series of enzymatic reactions and can be desorbed from its storage site with mild acidification.</p>Fórmula:C104H150N24O27Pureza:Min. 95%Peso molecular:2,168.45 g/molZ-Asu (OtBu)-OH·DCHA
CAS:Producto controlado<p>Please enquire for more information about Z-Asu (OtBu)-OH·DCHA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C20H29NO6·C12H23NPureza:Min. 95%Peso molecular:560.77 g/molZ-Phe-Arg-OMe·HCl
CAS:<p>Please enquire for more information about Z-Phe-Arg-OMe·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C24H31N5O5·HClPureza:Min. 95%Peso molecular:505.99 g/molAstressin trifluoroacetate salt
CAS:<p>Astressin trifluoroacetate salt H-D-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Nle-Ala-Arg-Ala-Glu-Gln is a cyclic peptide that has been shown to have biological properties as an inhibitor of cyclases. Astressin has shown efficacy in treating some types of autoimmune diseases and bowel diseases, although it is not effective against all types of these disorders. Astressin also has receptor activity and can induce locomotor activity. This compound has been shown to be an inhibitor of the Toll like receptor 4 (TLR4). In this role, astressin blocks the inflammatory response by preventing the binding of endotoxin to TLR4 receptors on cells.</p>Fórmula:C161H269N49O42Pureza:Min. 95%Peso molecular:3,563.16 g/molH-Phe-Arg-Arg-OH acetate salt
CAS:<p>The H-Phe-Arg-Arg-OH acetate salt is a reversible (acetylcholinesterase inhibitor). It reversibly binds to the enzyme, acetylcholinesterase and blocks the breakdown of acetylcholine, which is an important neurotransmitter. The H-Phe-Arg-Arg-OH acetate salt has been shown to be effective against rat hearts that have been damaged by lysosomal enzymes. This drug can also act as an endogenous buffer in the blood plasma, preventing changes in pH due to acidosis or alkalosis. The H-Phe-Arg-Arg-OH acetate salt is a subcomponent of citrate and myocardial proteins, which are essential for biosynthetic processes in the body. It has been shown to be maximally additive with other drugs that affect cardiac function, such as beta blockers and digitalis glycosides. Proteolysis is maximally inhibited by this drug when it</p>Fórmula:C21H35N9O4Pureza:Min. 95%Peso molecular:477.56 g/molIndole-3-acetic-L-alanine
CAS:<p>Indole-3-acetic-L-alanine is a plant hormone that regulates root formation and transport. It is found in all plants, but the concentration varies depending on the plant, tissue type, and growth conditions. It has been shown to regulate root formation in triticum aestivum by inhibiting auxin transport to the roots. Indole-3-acetic acid also inhibits auxin transport to the shoot apex, leading to increased branching in triticum aestivum. This compound is hydrolyzed by root cell enzymes into indole-3-acetate and L-alanine. Genetic mechanisms underlying this phenomenon are not well understood at this time.</p>Fórmula:C13H14N2O3Pureza:Min. 95%Forma y color:PowderPeso molecular:246.26 g/molFmoc-Pro-Pro-Pro-Pro-Pro-OH
CAS:<p>Please enquire for more information about Fmoc-Pro-Pro-Pro-Pro-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C40H47N5O8Pureza:Min. 95%Peso molecular:725.83 g/molH-Trp-Tyr-OH TFA Salt
CAS:<p>H-Trp-Tyr-OH TFA salt is a food additive that has been shown to inhibit the oxidation of casein by light. It is an amino acid analog, which is a synthetic compound containing a single amino acid. The H-Trp-Tyr-OH TFA salt has been shown to protect against photooxidation of casein and other proteins in milk. It also inhibits the formation of exciplexes, which are complexes formed between tryptophan and trifluoroacetic acid. The H-Trp-Tyr-OH TFA salt has been shown to be stable at pH values ranging from 2 to 12 and at temperatures up to 300 degrees Celsius. This additive can be used as an emulsifier in food products such as mayonnaise, salad dressing, and margarine.</p>Fórmula:C22H20N3F3O5Pureza:Min. 95%Peso molecular:463.41 g/molBoc-Cys(Mbzl)-PAM resin (200-400 mesh)
<p>Please enquire for more information about Boc-Cys(Mbzl)-PAM resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Bradykinin (1-7) acetate salt
CAS:<p>Bradykinin (1-7) acetate salt H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-OH acetate salt is a synthetic peptide that was designed to simulate the activity of bradykinin. It has been shown to be effective in the treatment of angina pectoris and as an analgesic. This peptide can also be used in the analysis of carboxypeptidase activity, by adding it to homogenates and measuring the reaction products. Bradykinin (1-7) acetate salt H-Arg-Pro-Pro-Gly-Phe-Ser-Pro-OH acetate salt can also be used to analyze salivary glands, activated erythrocytes, and silicon wafers. It is particularly useful for examining morphology and nanowires.</p>Fórmula:C35H52N10O9Pureza:Min. 95%Peso molecular:756.85 g/molDynorphin A (1-9)
CAS:<p>Dynorphin A (1-9) H-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-OH is a substrate binding inhibitor that blocks potassium channels. Dynorphin A (1-9) H-Tyr-Gly-Gly-Phe-Leu Arg Arg Ile Arg OH binds to the d -alanine site of the potassium channel and inhibits glutamate release from presynaptic terminals. Dynorphin A (1 9) H Tyr Gly Gly Phe Leu Arg Arg Ile Arg OH has been shown to be a potent inhibitor of aminopeptidase activity in vitro, which may be due to its affinity for the substrate binding site on the enzyme. Its inhibition of aminopeptidase activity may lead to an increase in opioid peptides such as dynorphins and enkephalins. Dynorphin A (1 9) H Tyr Gly Gly Phe</p>Fórmula:C52H84N18O11Pureza:Min. 95%Peso molecular:1,137.34 g/molH-Trp-Gly-Tyr-OH
CAS:<p>H-Trp-Gly-Tyr-OH is a carbohydrate binding molecule that has been shown to have an anhydrase activity. It also has sequences with homologous enzymes in other organisms, such as multienzyme and chromatographic enzymes. This molecule is soluble in water and insoluble in organic solvents. H-Trp-Gly-Tyr-OH binds to hemicellulosic carbohydrates and catarrhine carbonic anhydrase, which are found only in higher primates. Mutational analysis has shown that the H-Trp-Gly-Tyr-OH protein can be converted into a cyclopentadienyl derivative, which is not found in nature.</p>Fórmula:C22H24N4O5Pureza:Min. 95%Peso molecular:424.45 g/molFA-Ala-Phe-NH2
CAS:<p>FA-Ala-Phe-NH2 is a synthetic, hydrophobic peptide that mimics the structure of a spermatozoal regulatory protein. It has been shown to be an irreversible metal chelator and is used as a substrate in assays for metalloendopeptidases. In vitro studies have also shown that this peptide interacts with lectins and can inhibit the binding of spermatozoa to egg zona pellucida.</p>Fórmula:C19H21N3O4Pureza:Min. 95%Peso molecular:355.39 g/molH-Lys(retro-Glu-H)-OH
CAS:<p>Please enquire for more information about H-Lys(retro-Glu-H)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C11H21N3O5Pureza:Min. 95%Peso molecular:275.3 g/molOsteoblast-Adhesive Peptide
CAS:<p>Please enquire for more information about Osteoblast-Adhesive Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C21H43N11O6Pureza:Min. 95%Peso molecular:545.64 g/molAc-Lys-Gln-Leu-Arg-AFC trifluoroacetate salt
CAS:<p>Please enquire for more information about Ac-Lys-Gln-Leu-Arg-AFC trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C35H51F3N10O8Pureza:Min. 95%Peso molecular:796.84 g/molFmoc-Gly-Phe-OH
CAS:<p>Fmoc-Gly-Phe-OH is a photolytic residue that has been synthesized by solid-phase techniques. This molecule is an immobilized linker that can be used in photolabile devices to analyze the kinetics of biological processes. Fmoc-Gly-Phe-OH can also be used in supramolecular devices and regenerative medicine to measure the diameter of cells, as well as for regenerative purposes in humans.</p>Fórmula:C26H24N2O5Pureza:Min. 95%Peso molecular:444.48 g/molH-Arg-Phe-NH2 hydrochloride salt
CAS:<p>H-Arg-Phe-NH2 hydrochloride salt (H-RF) is a physiological agent that has been shown to have effects on the response element binding protein. H-RF is a small, water soluble molecule that has been shown to act as an agonist for peptides and cation channels in vitro. The peptides are involved in the regulation of cardiac function and locomotor activity, while the cation channel regulates the opening and closing of potassium channels. The binding of H-RF to these receptors leads to positive changes in energy metabolism, which may be due to its ability to activate ATPase. H-RF also binds strongly to disulfide bonds found in proteins such as peptide hormones and enzymes. These disulfide bonds are important for maintaining protein structure and function.</p>Fórmula:C15H24N6O2Pureza:Min. 95%Peso molecular:320.39 g/molN-Me-Thr(Bzl)-OH·HCl
CAS:<p>N-Me-Thr(Bzl)-OH·HCl is a soluble, hydroformylation catalyst with alkenyl and sulfonated substituents. It is used as a hydrogenation catalyst in the industrial production of polymers, detergents, and other organic chemicals. It can also be used to catalyze the reduction of carbonyl groups to alcohols in organic synthesis.<br>N-Me-Thr(Bzl)-OH·HCl is insoluble in water and can be converted into an insoluble form by reacting with HCl or NaOH. This product has been shown to have radical properties that allow it to catalyze the hydrogenation of alkenes and alkynes.</p>Fórmula:C12H17NO3·HClPureza:Min. 95%Peso molecular:259.73 g/molAllatotropin
CAS:<p>Allatotropin is a diagnostic agent that belongs to the class of antimicrobial peptides. It has been shown to have strong activity against Gram-positive and Gram-negative bacteria. Allatotropin inhibits the growth of bacteria by binding to the external membrane, disrupting its integrity. Allatotropin also has been shown to increase gamma-aminobutyric acid levels in brain tissue and galleria mellonella larvae when injected subcutaneously. This may be due to its ability to activate GABA receptors. Allatotropin can be synthesized in vitro by combining β-amino acids with fatty acids and terminal residues, such as lysine, arginine, and glutamine, under conditions that mimic those found in living cells. This synthetic process yields a mixture of allatotropins with varying chain lengths and amino acid sequences.</p>Fórmula:C65H103N19O17S2Pureza:Min. 95%Peso molecular:1,486.76 g/molH-Ala-Met-OH
CAS:<p>H-Ala-Met-OH is a hydrophobic amino acid. It is found in the sequence of a number of proteins, including hormones and enzymes. The optimum temperature for this amino acid is around 15 degrees Celsius, which is why it can be found in the cocrystallized dodecyl and racemized divalent forms. H-Ala-Met-OH has been shown to have divalent properties due to its ability to bind with two metal ions at the same time. H-Ala-Met-OH also has an amino acid sequence that can be found in many different proteins and enzymes, such as N-acetyl-L-tyrosine. This amino acid has been used as a target for bioinformatics studies on hormone sequences for the reaction mechanism.</p>Fórmula:C8H16N2O3SPureza:Min. 95%Peso molecular:220.29 g/molH-Leu-Gly-OtBu·HCl
CAS:<p>Please enquire for more information about H-Leu-Gly-OtBu·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C12H24N2O3·HClPureza:Min. 95%Peso molecular:280.79 g/molH-Pro-Phe-NH2·HCl
CAS:<p>Please enquire for more information about H-Pro-Phe-NH2·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C14H19N3O2·HClPureza:Min. 95%Peso molecular:297.78 g/molCys-CD36 (139-155) trifluoroacetate salt
CAS:<p>Please enquire for more information about Cys-CD36 (139-155) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C87H133N25O26SPureza:Min. 95%Peso molecular:1,977.21 g/molAutocamtide-2-Related Inhibitory Peptide
CAS:<p>Please enquire for more information about Autocamtide-2-Related Inhibitory Peptide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C64H116N22O19Pureza:Min. 95%Peso molecular:1,497.74 g/molFmoc-Arg(Pmc)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-Arg(Pmc)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Gly-Amyloid b-Protein (15-25)-Gly-ε-aminocaproyl(-Lys)6
CAS:<p>Please enquire for more information about Gly-Amyloid b-Protein (15-25)-Gly-epsilon-aminocaproyl(-Lys)6 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C105H178N28O26Pureza:Min. 95%Peso molecular:2,248.71 g/mol(Deamino-Cys1,b-cyclohexyl-Ala4,Arg8)-Vasopressin trifluoroacetate salt
CAS:<p>Desmopressin is a synthetic analogue of vasopressin, which is used to treat disorders associated with insufficient secretion of vasopressin. It has been shown that desmopressin binds to the vasopressin V2 receptor subtype and stimulates the release of arginine-vasopressin in corticotropin-releasing hormone (CRH)-treated rat pituitary cells. This stimulation was mediated by a residue on the Cys1,b-cyclohexyl residue. The binding of desmopressin to this site was demonstrated in vitro using binding experiments on rat brain synaptosomes. Desmopressin has also been shown to stimulate ovulation in rats and humans, and it has been shown to be effective for treating nocturnal enuresis in children.</p>Fórmula:C50H71N13O11S2Pureza:Min. 95%Peso molecular:1,094.31 g/molMethoxycarbonyl-Lys(Z)-Gly-Arg-pNA hydrochloride salt
CAS:<p>Please enquire for more information about Methoxycarbonyl-Lys(Z)-Gly-Arg-pNA hydrochloride salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C30H41N9O9Pureza:Min. 95%Peso molecular:671.7 g/mol2-Methylpyridine-4-boronic acid
CAS:<p>2-Methylpyridine-4-boronic acid is a reactive molecule that has been used in post-column derivatization and vivo studies. It has been shown to be reactive with mass spectrometric analysis, cancer assays, proteomics, and tumorigenic sample preparation. It also has been shown to have a molecular target of the cytochrome P450 reductase (CPR), which is involved in the metabolism of drugs and other xenobiotics. 2-Methylpyridine-4-boronic acid binds to CPR and inhibits its enzymatic activity, thereby affecting the metabolism of xenobiotics.</p>Fórmula:C6H8BNO2Pureza:Min. 95%Forma y color:White PowderPeso molecular:136.94 g/molFA-Phe-Ala-OH
CAS:<p>F-Phe-Ala-OH is a peptidyl amide that is ionizable at physiological pH. It has a constant and kinetic residue, as well as a hydrophobic, uncharged, and carboxypeptidase activity. F-Phe-Ala-OH catalyzes transpeptidation reactions between the amino acid residues of proteins. This reaction involves the elimination of one water molecule from the peptide bond to form an amine and an imine, which are then hydrolyzed to form the new peptide bond. The optimum pH for this catalysis is acidic.</p>Fórmula:C19H20N2O5Pureza:Min. 95%Peso molecular:356.37 g/molH-Arg-Trp-NH2·2 HCl
CAS:<p>Please enquire for more information about H-Arg-Trp-NH2·2 HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C17H25N7O2·2HClPureza:Min. 95%Peso molecular:432.35 g/mol(Tyr0)-Atriopeptin II (rat)
CAS:<p>Please enquire for more information about (Tyr0)-Atriopeptin II (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C107H165N35O34S2Pureza:Min. 95%Peso molecular:2,549.8 g/molFmoc-His(1-Trt)-Wang resin (100-200 mesh)
<p>Please enquire for more information about Fmoc-His(1-Trt)-Wang resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Cecropin A
CAS:<p>Cecropin A is an antimicrobial peptide, which is derived from the immune systems of insects, specifically moths. It displays potent antimicrobial properties through its ability to disrupt bacterial cell membranes, leading to cell lysis and death. This peptide primarily targets Gram-negative bacteria but is also effective against some Gram-positive strains. Cecropin A has garnered significant scientific interest due to its potential applications in developing new antimicrobial agents, particularly in the face of increasing antibiotic resistance. By integrating Cecropin A into therapeutic strategies, researchers aim to broaden the spectrum of antimicrobial options available for use in both clinical and agricultural settings, offering a promising avenue for future drug development.</p>Fórmula:C184H313N53O46Pureza:Min. 95%Peso molecular:4,003.78 g/mol(Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Arg13)-Amyloid b-Protein (1-40) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C194H300N54O58SPureza:Min. 95%Peso molecular:4,348.85 g/molH-Gly-Gly-Lys-OH acetate salt
CAS:<p>Please enquire for more information about H-Gly-Gly-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C10H20N4O4Pureza:Min. 95%Peso molecular:260.29 g/molFmoc-Pro-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Pro-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Fmoc-[D4]Ala-OH
CAS:Producto controlado<p>Please enquire for more information about Fmoc-[D4]Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C18H13D4NO4Pureza:Min. 95%Forma y color:PowderPeso molecular:315.35 g/molFmoc-D-Lys(Trt)-OH
CAS:<p>Please enquire for more information about Fmoc-D-Lys(Trt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C40H38N2O4Pureza:Min. 95%Peso molecular:610.74 g/molBoc-Val-Leu-Lys-AMC acetate salt
CAS:<p>Boc-Val-Leu-Lys-AMC acetate salt is a protease inhibitor that binds to the active site of trypsin and inhibits its proteolytic activity. It has been shown to protect neuronal cells from death caused by amyloid beta (Aβ) peptide. Boc-Val-Leu-Lys-AMC acetate salt also inhibits the secretion of proinflammatory cytokines and reduces the permeability of mitochondrial membranes in human neutrophils. This drug is stable in acidic environments, with a pH optimum of 2.0, but is sensitive to alkaline conditions with a pH optimum of 8.5. Boc-Val-Leu-Lys-AMC acetate salt has been shown to bind to casein, which may result in high values on sephadex g100 chromatography.</p>Fórmula:C32H49N5O7•C2H4O2Pureza:Min. 98 Area-%Forma y color:PowderPeso molecular:675.81 g/molZ-Asp(OtBu)-bromomethylketone
CAS:<p>Please enquire for more information about Z-Asp(OtBu)-bromomethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C17H22BrNO5Pureza:Min. 95%Peso molecular:400.26 g/molH-Val-Asn-OH
CAS:<p>H-Val-Asn-OH is a polyhydroxyamine that is soluble in water and has a low freezing point. It can be used as a coating material, sectioning medium, or to study the thermal expansion of materials. H-Val-Asn-OH has been shown to have no significant effect on the growth rate of bacteria and spores. H-Val-Asn-OH is made up of nitrogen atoms, ferrite, and strain. The microstructure of H-Val-Asn-OH includes a phase equilibrium with ferrite and strain morphology.</p>Fórmula:C9H17N3O4Pureza:Min. 95%Peso molecular:231.25 g/mol(Deamino-Cys11,D-2-Nal 14,Cys18)-b-MSH (11-22) amide trifluoroacetate salt
CAS:<p>Please enquire for more information about (Deamino-Cys11,D-2-Nal 14,Cys18)-b-MSH (11-22) amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C69H91N19O16S2Pureza:Min. 95%Peso molecular:1,506.71 g/molH-Lys-Tyr-Ser-OH
CAS:<p>H-Lys-Tyr-Ser-OH is a molecule that is the product of a racemase enzyme. This molecule is an acid with a pKa of 2.6, which means that it can exist as either a D or L form at pH values less than 2.6. The D form is more stable and has greater solubility in water than the L form. H-Lys-Tyr-Ser-OH stabilizes the conformation of erythromycin and other antibiotics by binding to Murein, which is the cell wall component responsible for conferring resistance to these drugs.</p>Fórmula:C18H28N4O6Pureza:Min. 95%Peso molecular:396.44 g/molAcetyl-(D-Trp1,4-chloro-D-Phe2,D-Trp3,D-Arg6,D-Ala10)-LHRH
CAS:<p>Please enquire for more information about Acetyl-(D-Trp1,4-chloro-D-Phe2,D-Trp3,D-Arg6,D-Ala10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C71H94ClN19O13Pureza:Min. 95%Peso molecular:1,457.08 g/molMethyl (2E)-3-(4-hydroxy-3-methoxyphenyl)acrylate
CAS:<p>Methyl (2E)-3-(4-hydroxy-3-methoxyphenyl)acrylate is a natural compound, which belongs to the group of ferulate esters. It has been shown that methyl (2E)-3-(4-hydroxy-3-methoxyphenyl)acrylate inhibits the activity of esterases, which are enzymes that hydrolyze esters. This inhibition leads to an accumulation of ferulic acid in the blood, which is associated with bowel disease. Methyl (2E)-3-(4-hydroxy-3-methoxyphenyl)acrylate has been shown to be effective against murine hepatoma cells and polymorphonuclear leucocytes, which are white blood cells that can be found in the blood and other tissues. The inhibitory effect on these cells may be due to its ability to bind to ferulic acid and caffeic acids.</p>Fórmula:C11H12O4Pureza:Min. 95%Forma y color:White PowderPeso molecular:208.21 g/molBoc-Asp(OcHex)-Merrifield resin (100-200 mesh)
<p>Please enquire for more information about Boc-Asp(OcHex)-Merrifield resin (100-200 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Lys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt
CAS:<p>Bradykinin is a peptide that is released in response to injury and inflammation. It has two receptors, B1 and B2. Bradykinin binds to the B2 receptor which leads to vasodilation, increased vascular permeability, and bronchoconstriction. Lys-(Des-Arg9,Leu8)-Bradykinin trifluoroacetate salt H-Lys-Arg-Pro-Pro-Gly-Phe-Ser-Pro-Leu (LBP) is a synthetic analogue of bradykinin that competes with bradykinin for binding sites on the bradykinin b2 receptor. LBP also inhibits lipoxygenase activity in vitro and in animals. This drug can be used as an antagonist against bradykinin b2 receptor or as an antiplatelet agent.</p>Fórmula:C47H75N13O11Pureza:Min. 95%Peso molecular:998.18 g/molZ-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone is an apoptosis inducer that belongs to the category of small molecules. It has been shown to induce apoptosis in cells by binding to DNA and inhibiting transcription, leading to DNA fragmentation and the activation of caspase-8. Z-Ile-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone has also been shown to have a synergistic effect on cells when combined with other potent inducers of apoptosis. This drug binds to toll receptors (TLR) and IL2 receptors, which are important for cell signaling pathways.</p>Fórmula:C30H43FN4O11Pureza:Min. 95%Peso molecular:654.68 g/mol5-Methoxy-3,4-dihydro-2H-pyrrole
CAS:<p>5-Methoxy-3,4-dihydro-2H-pyrrole is a chemical compound that contains a pyrrole ring. It can be found in the form of dehydrogenation and intramolecular hydrogen. 5-Methoxy-3,4-dihydro-2H-pyrrole has been shown to have antibacterial effects against Mycobacterium tuberculosis and other bacteria. 5-Methoxy-3,4-dihydro-2H-pyrrole also reacts with nitroacetate to form an aziridine, which is an intermediate in the synthesis of several pharmaceuticals. This chemical compound is used in the preparation of bipyrrole compounds such as naphthalene and alicyclic compounds such as nitrophenols.</p>Fórmula:C5H9NOPureza:Min. 95%Peso molecular:99.13 g/molAc-Ala-Ala-Pro-Ala-AMC
CAS:<p>Ac-Ala-Ala-Pro-Ala-AMC is a substrate for acetylcholinesterase and its structural analogues, including Ac-Ala-Glu-Phe. It has been found to be an isomerase that catalyzes the conversion of L-serine to D-serine in human cells. The enzyme displays a high resolution crystal structure with water molecules bound at the active site. The enzyme is a dimer composed of two identical monomers. The enzyme binds two substrates through hydrogen bonding interactions and then undergoes a conformational change, which releases the products as water molecules are released from the active site.</p>Fórmula:C26H33N5O7Pureza:Min. 95%Peso molecular:527.57 g/molH-Arg-His-NH2 acetate salt
CAS:<p>Please enquire for more information about H-Arg-His-NH2 acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C12H22N8O2Pureza:Min. 95%Peso molecular:310.36 g/molBoc-Pressinoic acid Boc-Cys-Tyr-Phe-Gln-Asn-Cys-OH (Disulfide bond)
CAS:<p>Please enquire for more information about Boc-Pressinoic acid Boc-Cys-Tyr-Phe-Gln-Asn-Cys-OH (Disulfide bond) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C38H50N8O12S2Pureza:Min. 95%Peso molecular:874.98 g/molH-Gly-Arg-Gly-Asp-Ser-Pro-OH
CAS:<p>H-Gly-Arg-Gly-Asp-Ser-Pro-OH is a cyclic peptide that contains five amino acids. It was synthesized by the reaction of L-glycine and D-alanine with D,L-aspartic acid and L,D,L-serine. HAGGS has been shown to stimulate the proliferation of fibroblast cells in vitro. The presence of HAGGS on the surface of human breast cancer cells (MDA MB 231) promotes the proliferation of these cells and stimulates the production of growth factor β1. HAGGS also activates integrin receptors on these cells, which are proteins that bind to collagen or fibronectin. This may be due to its ability to form disulfide bonds with neighboring proteins, such as fibronectin and integrin.</p>Fórmula:C22H37N9O10Pureza:Min. 95%Peso molecular:587.58 g/molOsteocalcin (45-49) (human)
CAS:<p>Please enquire for more information about Osteocalcin (45-49) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C30H39N5O7Pureza:Min. 95%Peso molecular:581.66 g/molZ-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone
CAS:<p>Please enquire for more information about Z-Leu-Glu(OMe)-Thr-DL-Asp(OMe)-fluoromethylketone including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C30H43FN4O11Pureza:Min. 95%Peso molecular:654.68 g/molCyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt
CAS:Please enquire for more information about Cyclo(-Arg-Ala-Asp-D-Phe-Cys) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C25H36N8O7SPureza:Min. 95%Peso molecular:592.67 g/molGhrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt
<p>Please enquire for more information about Ghrelin-Cys(BMCC-biotinyl) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C178H293N53O48S2Pureza:Min. 95%Peso molecular:4,007.69 g/molPAR-3 (1-6) amide (human) trifluoroacetate salt
<p>Please enquire for more information about PAR-3 (1-6) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C29H46N10O7Pureza:Min. 95%Peso molecular:646.74 g/molUrinary Trypsin Inhibitor Fragment
CAS:<p>Urinary Trypsin Inhibitor Fragment H-Arg-Gly-Pro-Cys-Arg-Ala-Phe-Ile-OH is a synthetic peptide that is used as a diagnostic agent. It has been shown to inhibit proinflammatory cytokines in vitro and in vivo. This peptide binds to the amino acid sequences of phospholipase A2, which are found in tumor cells, and can be used for cancer diagnosis. Urinary Trypsin Inhibitor Fragment H-Arg-Gly-Pro-Cys-Arg-Ala-Phe-Ile-OH also binds to DNA methylation, which may be useful for studying DNA methylation patterns in cancer cells.</p>Fórmula:C40H66N14O9SPureza:Min. 95%Peso molecular:919.11 g/molFmoc-β-Ala-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-beta-Ala-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Preangiotensinogen (11-14) (human) acetate salt
CAS:<p>Please enquire for more information about Preangiotensinogen (11-14) (human) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C21H35N7O6Pureza:Min. 95%Peso molecular:481.55 g/molH-Leu-2-chlorotrityl resin (200-400 mesh) (Low Substitution)
<p>Please enquire for more information about H-Leu-2-chlorotrityl resin (200-400 mesh) (Low Substitution) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Z-β-Ala-Gly-Gly-OH
CAS:<p>Please enquire for more information about Z-beta-Ala-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C15H19N3O6Pureza:Min. 95%Peso molecular:337.33 g/molUrotensin I
CAS:<p>Please enquire for more information about Urotensin I including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C210H340N62O67S2Pureza:Min. 95%Peso molecular:4,869.46 g/molH-β-Ala-Gly-OH
CAS:<p>H-beta-Ala-Gly-OH is a monoclinic crystalline compound. It is soluble in water and slightly soluble in ethanol, acetone, and benzene. The solubility of this compound depends on the pH of the solution as well as the presence of glycine. H-beta-Ala-Gly-OH has an upfield shift when protonated, making it useful for analytical purposes. This compound can be used to prepare glycine methyl ester by reacting with methanol or hydrochloric acid.</p>Fórmula:C5H10N2O3Pureza:Min. 95%Peso molecular:146.14 g/molCholecystokinin Octapeptide (1-4) (sulfated)
CAS:<p>Please enquire for more information about Cholecystokinin Octapeptide (1-4) (sulfated) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C20H28N4O11S2Pureza:Min. 95%Peso molecular:564.59 g/mol2-Methyl-3-(3,4-methylenediOxyphenyl)prOpanal
CAS:Producto controlado<p>2-Methyl-3-(3,4-methylenedioxyphenyl)propionaldehyde (2MMPP) is a minor constituent of piperonal. It has been shown to be a potent inhibitor of intracellular calcium levels in humans and rat prostate cancer cells. The mechanism of action is thought to be through an interaction with fatty acid receptors and alterations in cytosolic calcium levels. 2MMPP has been found to act as an odorant binding agent that binds to the olfactory receptor OR5AN1 and alters its function. 2-Methyl-3-(3,4-methylenedioxyphenyl)propionaldehyde has also been shown to have high electrochemical impedance spectroscopy values, which may indicate its ability to remove organic contaminants from wastewater treatment systems.</p>Fórmula:C11H12O3Pureza:Min. 95%Forma y color:Clear LiquidPeso molecular:192.21 g/molFmoc-Lys(N3)-OH
CAS:<p>Fmoc-Lys(N3)-OH is a glutamic acid molecule with a specific lysine and histidine residue. It has been shown to be cytotoxic in vitro, specifically targeting cancer cells. Fmoc-Lys(N3)-OH can be conjugated to vancomycin or other molecules that are not normally cell permeable for the treatment of neurodegenerative diseases. The divalent nature of this molecule allows it to cross the blood-brain barrier. Solid phase synthesis is used to produce this compound, which is then purified by chromatography and characterized by mass spectrometry.</p>Fórmula:C21H22N4O4Pureza:Min. 95%Peso molecular:394.42 g/molACTH (18-39) (human)
CAS:<p>ACTH is a polypeptide hormone that regulates the release of cortisol from the adrenal cortex. ACTH (18-39) is a fragment of ACTH which binds to the glucocorticoid receptor with high affinity. The carboxy terminal sequence of ACTH (18-39) is identical to that of human ACTH and can be used as an immunogen to produce monoclonal antibodies against ACTH. The monoclonal antibodies can then be used in prognostic studies for patients with congestive heart failure, diabetic neuropathy, or k562 cells. ACTH (18-39) has an optimum pH level of 7.0 and can bind to cellular receptors at physiological concentrations. It also has a molecular weight of 4,000 Daltons and is soluble in trifluoroacetic acid and hydrogen fluoride, but not in water or methanol.</p>Fórmula:C112H165N27O36Pureza:Min. 95%Peso molecular:2,465.67 g/molFluorogenic Human CMV Protease Substrate trifluoroacetate salt
CAS:<p>Please enquire for more information about Fluorogenic Human CMV Protease Substrate trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C73H109N23O18SPureza:Min. 95%Peso molecular:1,628.86 g/mol(Pro34)-Peptide YY (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro34)-Peptide YY (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C194H294N54O56Pureza:Min. 95%Peso molecular:4,278.74 g/molTyrosinase (206-214) (human) acetate salt
CAS:<p>H-AFLPWHRLF-OH peptide, corresponding to amino acids 206-214 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Fórmula:C61H83N15O10Pureza:Min. 95%Peso molecular:1,186.41 g/mol(Met(O)35)-Amyloid b-Protein (1-42)
CAS:<p>Please enquire for more information about (Met(O)35)-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C203H311N55O61SPureza:Min. 95%Peso molecular:4,530.04 g/mol(Val438)-Tyrosinase (432-444) (human) acetate salt
CAS:<p>H-SYLQDSVPDSFQD-OH peptide, corresponding to amino acids 432-444 of human Tyrosinase. The peptide is supplied as an acetate salt.</p>Fórmula:C65H93N15O26Pureza:Min. 95%Peso molecular:1,500.52 g/mol(Des-octanoyl)-Ghrelin (human) acetate salt
CAS:<p>Acetate salt</p>Fórmula:C141H235N47O41·xC2H4O2Pureza:Min. 95%Peso molecular:3,244.67 g/molPrion Protein (106-126) (human) (scrambled) trifluoroacetate salt
CAS:<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C80H138N26O24S2Pureza:Min. 95%Peso molecular:1,912.24 g/molHIV-1 tat Protein (49-57) trifluoroacetate salt
CAS:<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C53H106N30O11Pureza:Min. 95%Peso molecular:1,339.6 g/molMca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt
CAS:Please enquire for more information about Mca-Gly-Ala-Lys(Ac)-Arg-His-Arg-Lys-Val-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this pageFórmula:C54H85N19O13Pureza:Min. 95%Peso molecular:1,208.37 g/mol3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid
CAS:<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>Fórmula:C6H6F2N2O2Pureza:Min. 95%Forma y color:White Off-White PowderPeso molecular:176.12 g/molFGF acidic I (102-111) (bovine brain)
CAS:<p>Please enquire for more information about FGF acidic I (102-111) (bovine brain) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C59H82N16O13Pureza:Min. 95%Peso molecular:1,223.38 g/molPyr-Phe-Leu-pNA
CAS:<p>Pyr-Phe-Leu-pNA is a proteolytic enzyme that is used in the production of monoclonal antibodies. The enzyme was originally isolated from human pancreas, but has also been found in other sources including eggs, bovine pancreas, and various bacteria. Pyr-Phe-Leu-pNA hydrolyzes peptide bonds with a preference for serine and threonine residues. This enzyme has been shown to be effective at cleaving influenza virus protein hemagglutinin, which may be useful in the development of new vaccines. Pyr-Phe-Leu-pNA has also been shown to have high salt tolerance, making it a good candidate for use in food processing applications.</p>Fórmula:C26H31N5O6Pureza:Min. 95%Peso molecular:509.55 g/molFmoc-p-nitro-Phe-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-p-nitro-Phe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Neuromedin N trifluoroacetate salt
CAS:<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>Fórmula:C38H63N7O8Pureza:Min. 95%Peso molecular:745.95 g/molDL-Tyrosine ethyl ester hydrochloride
CAS:<p>DL-Tyrosine ethyl ester hydrochloride is a reagent and reaction component that is used in the synthesis of many complex compounds. It is a high quality chemical that has been shown to be useful as a building block for the synthesis of complex compounds. DL-Tyrosine ethyl ester hydrochloride has CAS No. 5619-08-9, which makes it a versatile building block with wide applications in research. This compound can also be used as an intermediate or as a reagent in the synthesis of other chemicals. DL-Tyrosine ethyl ester hydrochloride can be used as a speciality chemical or as a research chemical due to its high quality and versatility.</p>Fórmula:C11H16ClNO3Pureza:Min. 95%Forma y color:White to off white solid.Peso molecular:245.7 g/mol4-Methoxybenzylboronic acid pinacolester
CAS:<p>Please enquire for more information about 4-Methoxybenzylboronic acid pinacolester including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C14H21BO3Pureza:Min. 95%Peso molecular:248.13 g/molGRF (ovine, caprine) trifluoroacetate salt
CAS:<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Fórmula:C221H368N72O66SPureza:Min. 95%Peso molecular:5,121.8 g/molFGF basic (119-126) (human, mouse, rabbit, rat)
CAS:<p>Please enquire for more information about FGF basic (119-126) (human, mouse, rabbit, rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C44H76N14O12Pureza:Min. 95%Peso molecular:993.16 g/mol2-Chloro-6-methoxypyridine
CAS:<p>2-Chloro-6-methoxypyridine (2CMP) is a potent antagonist that binds to copper chloride, inhibiting its ability to activate aryl chlorides. This chemical has been shown to have anti-angiogenic effects in human cancer cells and can be used for the treatment of cancer. 2CMP has also been shown to be effective at blocking angiogenesis in mice with breast cancer. 2CMP is synthesized through an asymmetric synthesis process, which involves the use of a dipole and molecular docking analysis.</p>Fórmula:C6H6ClNOPureza:Min. 95%Forma y color:Clear LiquidPeso molecular:143.57 g/molLIP1 (human) trifluoroacetate salt
<p>Please enquire for more information about LIP1 (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C133H229N45O37Pureza:Min. 95%Peso molecular:3,050.52 g/molNeuropeptide FF (5-8) acetate salt
CAS:<p>Please enquire for more information about Neuropeptide FF (5-8) acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C25H39N9O5Pureza:Min. 95%Peso molecular:545.63 g/molFmoc-Ala-(Dmb)Gly-OH
CAS:<p>Please enquire for more information about Fmoc-Ala-(Dmb)Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C29H30N2O7Pureza:Min. 95%Peso molecular:518.56 g/molH-2,6-Difluoro-Phe-OH·HCl
CAS:<p>Please enquire for more information about H-2,6-Difluoro-Phe-OH·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C9H9F2NO2·HClPureza:Min. 95%Peso molecular:237.63 g/molZ-Tyr-Tyr-OH
CAS:<p>Please enquire for more information about Z-Tyr-Tyr-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C26H26N2O7Pureza:Min. 95%Peso molecular:478.49 g/molAngiotensin (1-12) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Angiotensin (1-12) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C73H109N19O16Pureza:Min. 95%Peso molecular:1,508.77 g/mol(Tyr1)-pTH (1-34) (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr1)-pTH (1-34) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C189H295N55O51S2Pureza:Min. 95%Peso molecular:4,217.84 g/mol(Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Tyr34)-pTH (7-34) amide (bovine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C156H244N48O40S2Pureza:Min. 95%Peso molecular:3,496.04 g/molLeu-Leu-OMe·HCl
CAS:<p>Leu-Leu-OMe·HCl is a reagent that is used as a reaction component. It is soluble in water and has a pH of 2.0. Leu-Leu-OMe·HCl is also useful for the synthesis of building blocks and fine chemicals with versatile applications, such as bioactive compounds and pharmaceuticals. This chemical has been shown to react with other molecules to form a variety of complex compounds, making it useful for research purposes. This compound can be used as an intermediate in the synthesis of many different products, including pharmaceuticals, pesticides, and insecticides.</p>Fórmula:C13H26N2O3·HClPureza:Min. 95%Forma y color:PowderPeso molecular:294.82 g/molN-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about N-Me-Abz-Lys-Pro-Leu-Gly-Leu-Dap (Dnp)-Ala-Arg-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C51H79N17O13Pureza:Min. 95%Peso molecular:1,138.28 g/mol(Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt
<p>Please enquire for more information about (Des-Gly10,Ser(Ac)4,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C61H86N16O13Pureza:Min. 95%Peso molecular:1,251.44 g/molGalanin (1-13)-Mastoparan
CAS:<p>Galanin is a peptide that is part of the galaninergic system. It is involved in the regulation of insulin resistance, pain sensation, and chronic bronchitis. Galanin has been found to inhibit ATP-sensitive K+ channels and to have an inhibitory effect on ryanodine receptors. This inhibition leads to an increase in cytosolic Ca2+. Galanin also inhibits the release of inflammatory cytokines such as IL-1β, IL-6, and TNF-α. The biological properties of galanin are not fully understood and it may be associated with cancer and autoimmune diseases.</p>Fórmula:C133H222N34O32Pureza:Min. 95%Peso molecular:2,809.4 g/molOM99-2trifluoroacetate salt
CAS:<p>Please enquire for more information about OM99-2trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C41H64N8O14Pureza:Min. 95%Peso molecular:892.99 g/molFmoc-Asp-OAll
CAS:<p>Fmoc-Asp-OAll is a cyclic peptide that has been shown to be active against human cancer cell lines in vitro. Fmoc-Asp-OAll binds to integrin receptors, inhibiting the prostaglandin synthesis pathway and thus reducing inflammation. It also inhibits the activity of enzymes that are involved in inflammatory responses. Fmoc-Asp-OAll is synthesized on solid phase by chemical ligation.</p>Fórmula:C22H21NO6Pureza:Min. 95%Forma y color:PowderPeso molecular:395.41 g/molFmoc-Pen (Trt)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Pen (Trt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt
CAS:<p>H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt is a synthetic amino acid. It has been shown to be a substrate for peptidases and proteolytic enzymes, including serine protease. H-Leu-Trp-Met-Arg-Phe-Ala-OH acetate salt also has catalytic activity, which leads to the formation of methyl ketones. This product is used as an analytical reagent in the determination of specificities of proteolytic enzymes. It is also used to measure the activity of amyloid protein and peptidases.</p>Fórmula:C40H58N10O7SPureza:Min. 95%Peso molecular:823.02 g/molBoc-Pro-Leu-Val-OMe
CAS:<p>Boc-Pro-Leu-Val-OMe is a peptide analog of Dolastatin 10 which has been shown to inhibit the production of ATP in mitochondria. The compound binds to the active site of bacterial topoisomerase IV, and this binding prevents the enzyme from cleaving DNA. Boc-Pro-Leu-Val-OMe is a small molecule that has an intramolecular structure, and it interacts with DNA to form a stable complex.</p>Fórmula:C22H39N3O6Pureza:Min. 95%Peso molecular:441.56 g/molFmoc-Cys(tBu)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Cys(tBu)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%Fmoc-D-Arg(Pbf)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-D-Arg(Pbf)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%(Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt
CAS:<p>Please enquire for more information about (Pro34)-Neuropeptide Y (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C190H286N54O56Pureza:Min. 95%Peso molecular:4,222.63 g/molHIV Protease Substrate IV
CAS:<p>Please enquire for more information about HIV Protease Substrate IV including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C49H83N15O13Pureza:Min. 95%Peso molecular:1,090.28 g/molFmoc-L-aspartic acid β-allyl ester
CAS:<p>Fmoc-L-aspartic acid beta-allyl ester is a specific interaction between an amide and an enzyme target. It has been shown to have anti-inflammatory properties by inhibiting the activity of COX-2, which inhibits the production of prostaglandins. Fmoc-L-aspartic acid beta-allyl ester is a cyclic peptide with a lactam ring system that has been synthesized in a stepwise manner on a solid phase. This molecule interacts with cell line A549 and blocks the proliferation of cancer cells. Fmoc-L-aspartic acid beta-allyl ester also contains a disulfide bond that stabilizes its structure.</p>Fórmula:C22H21NO6Pureza:Min. 95%Peso molecular:395.41 g/molH-Ile-Ala-OH
CAS:<p>H-Ile-Ala-OH is a high quality product that has been extensively validated for its stability and effectiveness. It is a zymogen that has been shown to be active against pancreatic enzymes. H-Ile-Ala-OH binds to the hydrophobic region of the enzyme, which may be due to hydrogen bonding. The diameter of this molecule is 8.3 Ångströms, which allows it to bind to the enzyme's active site. H-Ile-Ala-OH has been shown to have prognostic value in cancer patients and can be used as a profile marker in porcine cells.</p>Fórmula:C9H18N2O3Pureza:Min. 95%Peso molecular:202.25 g/molCyclo(-Pro-Thr)
CAS:<p>Cyclo(-Pro-Thr) is a cyclic peptide that is derived from the amino acid sequence of serotonin. Cyclo(-Pro-Thr) has been detected in human urine, and it is possible that this compound may be formed by the hydrolysis of serotonin by enzymes such as pipecolate oxidase. The presence of cyclo(-Pro-Thr) in human urine has been correlated with the occurrence of stomach ulcers, which are caused by substances such as famotidine and other proton pump inhibitors. Cyclo(-Pro-Thr) has also been found to inhibit the production of gamma-aminobutyric acid (GABA), which is an important neurotransmitter for controlling muscle tone, blood pressure, and anxiety.</p>Fórmula:C9H14N2O3Pureza:Min. 95%Peso molecular:198.22 g/molMastoparan 17 (free acid)
CAS:<p>Please enquire for more information about Mastoparan 17 (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C70H131N19O16Pureza:Min. 95%Peso molecular:1,494.91 g/mol3,5-Diiodo-4-methoxybenzhydrazide
CAS:<p>3,5-Diiodo-4-methoxybenzhydrazide is a high quality chemical that is useful in the preparation of complex compounds. This compound has been shown to be an excellent reagent and useful intermediate for the synthesis of various fine chemicals. It has been used as a precursor for the production of the antiviral drug Tamiflu, among other pharmaceuticals. 3,5-Diiodo-4-methoxybenzhydrazide is also a versatile building block that can be used in research or as a reaction component in organic synthesis.</p>Fórmula:C8H8I2N2O2Pureza:Min. 95%Forma y color:PowderPeso molecular:417.97 g/molH-Gly-Leu-Tyr-OH
CAS:<p>H-Gly-Leu-Tyr-OH is a tripeptide that is found in some human and animal proteins. The peptide contains glycine, leucine, tyrosine, and hydroxyproline. It binds to copper ions with an inhibition constant of 1.5 x 10^5 M and has a pH optimum of 7.0. In the active form, it inhibits α subunit of bacterial aminopeptidase which is required for protein synthesis in bacteria. The peptide also has been shown to be a model system for the study of enzyme mechanisms and as a chromatographic method for analyzing proteins in food chemistry.</p>Fórmula:C17H25N3O5Pureza:Min. 95%Peso molecular:351.4 g/molH-Pro-Ser-Hyp-Gly-Asp-Trp-OH
CAS:<p>H-Pro-Ser-Hyp-Gly-Asp-Trp-OH is a cyclic hexapeptide with a high activity against platelets. It is an antagonist of the cyclic RGD sequence, which is present in fibrinogen, fibronectin, vitronectin and other proteins. This peptide binds to the n-terminal residue of these proteins and prevents them from binding to their receptors on the surface of platelets. H-Pro-Ser-Hyp-Gly-Asp-Trp-OH has been shown to be specific for human platelets and does not bind to erythrocytes or leukocytes.</p>Fórmula:C30H39N7O11Pureza:Min. 95%Peso molecular:673.67 g/molH-His-Phe-OH
CAS:<p>H-His-Phe-OH is a polypeptide that is used in the diagnosis of chronic kidney disease. It is synthesized by the chemical reaction between histidine and phenylalanine. H-His-Phe-OH has been shown to have a molecular weight of 4,000 Da, with a diameter of 5 nm. The binding constants for this molecule are 3.5 x 10^6 M^(-1), and its stability in biological fluids has been shown to be greater than 100 hours at pH 7.4, 37°C.</p>Fórmula:C15H18N4O3Pureza:Min. 95%Peso molecular:302.33 g/molSuc-Tyr-Val-Ala-Asp-pNA
CAS:<p>Please enquire for more information about Suc-Tyr-Val-Ala-Asp-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C31H38N6O12Pureza:Min. 95%Peso molecular:686.67 g/molH-Phe-Pro-bNA·HCl
CAS:<p>Please enquire for more information about H-Phe-Pro-bNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C24H25N3O2·HClPureza:Min. 95%Peso molecular:423.93 g/molBoc-Tyr(Bzl)-aldehyde
CAS:<p>Please enquire for more information about Boc-Tyr(Bzl)-aldehyde including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C21H25NO4Pureza:Min. 95%Peso molecular:355.43 g/molHippuryl-Lys-OH
CAS:<p>Hippuryl-Lys-OH is a novel, potent and selective serine protease inhibitor that targets human cathepsin B. It has been shown to have inhibitory properties against other serine proteases such as chymotrypsin, trypsin, and elastase. Hippuryl-Lys-OH is used in the treatment of cancer patients with diabetes who require a creatine level less than 400 μM per liter of serum. It also has potential applications in the treatment of Alzheimer's disease and Parkinson's disease due to its ability to inhibit polymerase chain reactions (PCR).</p>Fórmula:C15H21N3O4Pureza:Min. 95%Peso molecular:307.35 g/mol(D-His2,D-Ser(tBu)6,Azagly10)-LHRH
CAS:<p>Please enquire for more information about (D-His2,D-Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C59H84N18O14Pureza:Min. 95%Peso molecular:1,269.41 g/molFmoc-Asn(Trt)-Wang resin (200-400 mesh)
<p>Please enquire for more information about Fmoc-Asn(Trt)-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Pureza:Min. 95%H-Ala-Gly-OH
CAS:<p>H-Ala-Gly-OH is a synthetic amino acid that is used to produce the peptide hormone luteinizing hormone (LH). It has been shown that H-Ala-Gly-OH is an antigen specific antibody response and has a hydrogen bond. The functional groups of H-Ala-Gly-OH include amine, carboxyl, and hydroxyl. Structural analysis of this compound was completed using a kinetic method. The conformational properties of H-Ala-Gly-OH were determined by nmr spectra and titration method. This synthetic amino acid may inhibit protein synthesis in vivo through treatment with carbohydrate.</p>Fórmula:C5H10N2O3Pureza:Min. 95%Peso molecular:146.14 g/mol1-Ethyl-3-methylimidazolium Ethyl Sulfate
CAS:<p>1-Ethyl-3-methylimidazolium ethyl sulfate is a surfactant that has a high thermal expansion coefficient. It can be used as a solvent to dissolve ionic substances and can be used in experiments involving hydrogen fluoride, ionic liquids, and reaction mechanisms. 1-Ethyl-3-methylimidazolium ethyl sulfate is not toxic to cells and animals in the short term, but the long term effects of this compound are unknown. The heat capacity of this substance is high and it has been shown to emit light when exposed to xrays. This compound also shows hydrogen bonding interactions with other ions in solution.</p>Fórmula:C8H16N2O4SPureza:Min. 95%Peso molecular:236.29 g/mol(β-Ala70)-C3a (70-77)
CAS:<p>Please enquire for more information about (Beta-Ala70)-C3a (70-77) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C35H61N13O10Pureza:Min. 95%Peso molecular:823.94 g/molFmoc-S-trityl-L-penicillamine
CAS:<p>Fmoc-S-trityl-L-penicillamine is a coordination compound that contains a thiolate and amide group. It has been used as a model system for studying the interaction between proteins and metal ions, with the cyclic structure mimicking the active site of enzymes. The coordination of Fmoc-S-trityl-L-penicillamine to proteins is affected by trypsin, an enzyme that cleaves peptides at carboxyl side chains. Trypsin can also lead to dehydration of Fmoc-S-trityl-L-penicillamine, forming an eliminations product. This compound also reacts with lysine residues in proteins, resulting in an alkene byproduct that can be removed by hydrogenation.</p>Fórmula:C39H35NO4SPureza:Min. 95%Forma y color:PowderPeso molecular:613.77 g/molZ-Arg-AMC hydrochloride salt
CAS:<p>Z-Arg-AMC hydrochloride salt is a proteolytic agent that inhibits serine proteases. It can be used to study the biological function of proteases and as a tool in the kinetic analysis of protease activity. Z-Arg-AMC hydrochloride salt has been shown to inhibit trypsin, chymotrypsin, and elastase enzymes at nanomolar concentrations. This compound also inhibits human pathogens such as enterovirus 71 and herpes simplex virus type 1, which are associated with severe disease symptoms. The structural analysis of Z-Arg-AMC hydrochloride salt has shown it to be a racemic mixture of L-Arginine and D-Arginine with an average molecular weight of 313.5 Da.</p>Fórmula:C24H27N5O5Pureza:Min. 95%Peso molecular:465.5 g/mol(Trp6)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Trp-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt
CAS:<p>Please enquire for more information about (Trp6)-LHRH trifluoroacetate salt Pyr-His-Trp-Ser-Tyr-Trp-Leu-Arg-Pro-Gly-NH2 trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C64H82N18O13Pureza:Min. 95%Peso molecular:1,311.45 g/molH-Arg-Val-OH acetate salt
CAS:<p>H-Arg-Val-OH acetate salt is a recombinant humanized monoclonal antibody that binds to the serine protease, which is an enzyme that cleaves proteins at specific sites. The antibody inhibits the activity of this enzyme and prevents the release of proteins from cells. It has been shown to be clinically relevant in treating heart failure, chronic pulmonary disease, and congenital heart disease. In addition, H-Arg-Val-OH acetate salt inhibits the release of inflammatory molecules like interleukin 6 (IL6) and tumor necrosis factor alpha (TNFα), which are involved in a variety of diseases.</p>Fórmula:C11H23N5O3Pureza:Min. 95%Peso molecular:273.33 g/molAc-Ile-Glu-Pro-Asp-pNA
CAS:<p>Ac-Ile-Glu-Pro-Asp-pNA is a synthetic peptide that has been shown to induce apoptosis in tumor cells. The peptide was found to cause cell lysis and necrotic cell death, which is associated with the activation of serine proteases. Ac-Ile-Glu-Pro-Asp-pNA also has been shown to have a toxicity profile similar to other apoptotic agents such as staurosporine, but it has not been tested for its ability to kill cancer cells without causing damage to healthy cells. Ac-Ile-Glu-Pro-Asp-pNA induces mitochondrial membrane depolarization and protein synthesis inhibition in K562 cells, which are human erythroleukemia cells. This peptide also has shown an ability to bind with monoclonal antibodies and inhibit the growth of casein.</p>Fórmula:C28H38N6O11Pureza:Min. 95%Peso molecular:634.64 g/molH-Arg-Met-OH acetate salt
CAS:<p>H-Arg-Met-OH acetate salt is a reactive chemical that is used in the treatment of hepatitis. It has been shown to be effective against virus and heart disease, as well as being active in the prevention of insulin resistance. H-Arg-Met-OH acetate salt is also used to determine if a person has had an allergic reaction by testing for elevated serum levels of this chemical. H-Arg-Met-OH acetate salt can be found in the blood, urine, and liver cells. This chemical is also present in mouse spleen cells and has been shown to react with specific antibodies.</p>Fórmula:C11H23N5O3SPureza:Min. 95%Peso molecular:305.4 g/molH-D-His(Bzl)-OH
CAS:<p>Please enquire for more information about H-D-His(Bzl)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Fórmula:C13H15N3O2Pureza:Min. 95%Peso molecular:245.28 g/mol
