Anticorps primaires
Sous-catégories appartenant à la catégorie "Anticorps primaires"
- Anticorps pour la recherche sur le cancer(3.721 produits)
- Anticorps cardio-vasculaires(2 produits)
- Biologie du développement(764 produits)
- Anticorps relatifs à l’épigénétique(162 produits)
- Anticorps d'immunologie(2.585 produits)
- Anticorps du métabolisme(286 produits)
- Anticorps de microbiologie(740 produits)
- Transduction du signal(2.765 produits)
- Tags & Marqueurs cellulaires(34 produits)
75512 produits trouvés pour "Anticorps primaires"
MYL3 antibody
MYL3 antibody was raised in Mouse using a purified recombinant fragment of MYL3 expressed in E. coli as the immunogen.
Cathepsin D antibody
The Cathepsin D antibody is a highly sensitive detection tool commonly used in immunoassays within the Life Sciences industry. This antibody is designed to specifically target and bind to Cathepsin D, an enzyme involved in various cellular processes. Its ultrasensitive detection capabilities make it ideal for research and diagnostic applications.
NOTCH3 antibody
The NOTCH3 antibody is a powerful tool in the field of Life Sciences. It specifically targets and binds to the activated form of NOTCH3, a growth factor involved in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.
SSTR2 antibody
The SSTR2 antibody is a highly specialized monoclonal antibody that targets the somatostatin receptor 2 (SSTR2). This antibody has been extensively studied and characterized for its ability to specifically bind to SSTR2, making it an invaluable tool in various research applications.
Granzyme A antibody
Granzyme A antibody is a monoclonal antibody that specifically targets and binds to granzyme A, a serine protease enzyme involved in immune response and cell death. This antibody can be used for various applications in the field of Life Sciences, including research on immune system function, cancer therapy, and autoimmune diseases. It has been shown to inhibit the activity of granzyme A by blocking its binding to target cells. Additionally, this antibody has been used in experiments to study the effects of granzyme A on dopamine release, hormone peptide processing, and liver microsome metabolism. With its high specificity and affinity for granzyme A, this monoclonal antibody is a valuable tool for researchers studying immune regulation and cell signaling pathways.
SQSTM1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. The drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
FBXL16 antibody
FBXL16 antibody was raised using the middle region of FBXL16 corresponding to a region with amino acids GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE
Streptococcus Group A antibody (FITC)
Streptococcus group A antibody (FITC) was raised in rabbit using group A Streptococci as the immunogen.
