Peptides

Fmoc-Gly-Arg(Pbf)-OH is a dipeptide building block that can be used in the synthesis of peptides. It is an analogue of Gly-Pro and Arg(Pbf)-OH, which are also dipeptide building blocks. The properties of Fmoc-Gly-Arg(Pbf)-OH make it suitable for peptide synthesis through solid phase chemistry. Dipeptides are important tools for the synthesis of peptides, as they are easy to handle and modify. They are also used as building blocks for constructing more complex molecules such as proteins or nucleic acids.

<p>IL-6 Mouse is a recombinant protein that belongs to the cytokine family. It has been shown to activate IL-6 receptor. This receptor is a member of the GPCR family and possesses seven transmembrane domains with a large extracellular loop between TM2 and TM3. The extracellular domain contains binding sites for two different classes of ligands, including peptides and proteins. IL-6 Mouse is an antibody against IL-6 receptor that can be used as a research tool in pharmacology, protein interactions, cell biology, or immunology.<br>IL-6 Mouse is produced by high purity process and it contains no detectable levels of endotoxin or pyrogens.</p>

<p>H-Asp(2-ClTrt-Resin)-OtBu (α Ester) is a building block that is used in peptide synthesis. It can be resubstituted with the amino acid, aspartic acid, and used in the formation of peptides. This resin is insoluble in water and soluble in dichloromethane and dimethylformamide. The H-Asp(2-ClTrt-Resin)-OtBu (α Ester) can also be used to form disulfides or thioethers.</p>

TentaGel resin; constructed with a backbone of low cross-linked polystyrene grafted with polyoxyethylene (polyethylene glycol). The typical chain length of POE (n) is approximately 68 ethylene oxide units or an average MW of 3000. This long chain creates a spacer that effectively separates the reactive site (X) from the crosslinked backbone matrix. TentaGel; HL (High Load) (mean particle size 110 µm: capacity 04-06 meq/g)

<p>FK18 is a basic fibroblastic growth factor that has been shown to promote neuronal survival and is neuroprotective. It also can prevent glutamate-induced neurotoxicity in the central nervous system (CNS) by inhibiting glutamate release from the synaptic cleft, which leads to neuronal death. FK18 has been shown to have anti-inflammatory properties, which may be due to its ability to inhibit the production of prostaglandins and other inflammatory mediators. FK18 has also been shown to reduce necrotic cell death by decreasing mitochondrial membrane potential.</p>

H-Lys-Asp-OH is a molecule that binds to the receptor binding molecule for the colony stimulating factor. It has been shown to be effective in protecting against experimental models of hepatic steatosis and monoclonal antibody induced liver injury. The therapeutic potential of H-Lys-Asp-OH is being investigated as a treatment for human hepatic steatosis, which is a condition characterized by high levels of fat in the liver. This drug also has pharmacokinetic properties that are important in its use as an experimental model for studying the effects of antibiotics on bacterial DNA synthesis, and as a diagnostic tool for detecting antibiotic resistant bacteria.

Please enquire for more information about LL-37 amide trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>H-Pro-Val-OH is an amide that is used to treat renal disorders by inhibiting leukocyte elastase. It has been shown to be a potent inhibitor of serine proteases, including chymotrypsin and trypsin. H-Pro-Val-OH binds to the active site on serine proteases and blocks the release of peptides from the enzyme. The binding constant for H-Pro-Val-OH with chymotrypsin was found to be in the range of 3 x 10 M, which is significantly higher than that for other amides. In addition, H-Pro-Val-OH inhibits cytolysis by lysosomal enzymes and protects against liver injury caused by chronic liver disease. This drug also shows low molecular weight and high water solubility, making it effective in treating acute hepatitis.</p>

Please enquire for more information about rec IL-4 (murine) including the price, delivery time and more detailed product information at the technical inquiry form on this page

<p>H-Phe-Pro-OH is a cyclic peptide that is a structural mimic of the natural amino acid gamma-aminobutyric acid (GABA) and has been shown to be an effective inhibitor of the p450 enzymes responsible for carcinogen activation. The peptide binds to response elements in DNA and RNA, which prevents transcription of genes that are involved in cancer development. H-Phe-Pro-OH also inhibits collagen production and has hemolytic activity due to hydrogen bonding with erythrocytes. This peptide can be used as an antimicrobial agent against Gram negative bacteria, including Pseudomonas aeruginosa, Klebsiella pneumoniae, Escherichia coli, and Salmonella typhimurium. In addition, it has been shown to inhibit the growth of Gram positive bacteria such as Staphylococcus aureus and Clostridium perfringens. The mechanism by which this compound inhibits bacterial growth is</p>

Influenza B labelled 5-peptide mixture of: H-SHFANLK^-OHH-SYFANLK^-OHH-GVLLPQK^-OHH-NLNSLSELEVK^-OHH-GILLPQK^-OH K^ = Lysine (U-13C6,15N2) 100 aliquots/pack total to equal 1nmol/peptide/vial dry aliquots

H-Gly-Ala-AMC monohydrochloride is a chemical that is used as a reaction component or reagent in pharmaceutical and research laboratories. It has been shown to be a useful scaffold for the synthesis of complex compounds. This compound is also used as an intermediate in the synthesis of other fine chemicals. H-Gly-Ala-AMC monohydrochloride can be used as a building block for the production of versatile building blocks, which are useful for making speciality chemicals.

<p>H-Glu(Val-OH)-OH is a synthetic form of l-glutamic acid. It increases the activity of glutamyl synthetase, which is an enzyme that regulates the synthesis of glutathione. H-Glu(Val-OH)-OH has been shown to have anticarcinogenic effects in animal studies. This compound also inhibits the synthesis of alpha-tocopherol, which is a molecule that protects against oxidative stress and is essential for maintaining cell membranes. H-Glu(Val-OH)-OH may be useful as a dietary supplement for individuals with low body mass index (BMI) or cancer patients undergoing chemotherapy. H-Glu(Val-OH)-OH may be used to treat obesity by increasing energy expenditure and decreasing appetite, although it does not affect glucose levels in mice. The mechanism by which this compound affects obesity is yet unknown, but it may be due to its ability to activate proinflammatory cytokines such as TNFα</p>

H-Thr-Phe-Leu-Leu-Arg-NH2 is a peptide that has been shown to reduce the severity of lung inflammation and injury in rats with pulmonary hypertension. It also prevents the release of proinflammatory cytokines such as tumor necrosis factor alpha (TNFα) and interleukin 6 (IL6). This peptide also induces an antibody response against collagen gel, which is used to treat fibrotic diseases and wounds. The peptide binds to the soybean trypsin inhibitor, preventing it from inhibiting protease enzymes, thereby allowing for protein synthesis. H-Thr-Phe-Leu-Leu-Arg-NH2 has been shown to have antiapoptotic effects by restoring mitochondrial membrane potential in cancer cells. This peptide can be used as a therapeutic agent for various diseases including primary pulmonary hypertension, cancer tissues, and mitochondrial disorders.

Adiponectin receptor (AdipoR1/AdipoR2) agonist.

<p>Substance P (SP) is a peptide that is highly conserved across the animal kingdom and is involved in a number of inflammatory and growth promoting processes. SP has a net positive charge at physiological pH, it is an amphiphilic peptide with positively charged residues at the N-terminus and hydrophobic residues at the C-terminus, this controls how it interacts with cell membranes. SP is stable in plasma (several hours) but has a short half-life in tissues (seconds/minutes).SP is encoded by the TAC1 gene and is a member of the tachykinin peptide hormone family. SP is expressed by many cell types including: neurons, astrocytes, microglia, epithelial cells, endothelial cells, immune cells such as T cells and macrophages- dendritic cells and eosinophils and some stem cells and progenitor cells. The huge variety of cell types expressing SP suggest it is involved in a wide variety of physiological and pathophysiological functions.SP mediates its functions by interacting with members of the neurokinin (NK) family of G protein-coupled receptors with high selectivity. Among these, SP binds to NK1R with the highest affinity, this receptor is expressed in a wide range of tissue types.Biotin (B7) has been added to the N-terminus.</p>

<p>Please enquire for more information about Biotinyl-Gly-Gly-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

Endogenous calcitonin gene-related peptide receptor (CGRP) agonist which is secreted in both peripheral and central neurons. It is a potent vasodilator and can function in the transmission of nociception as well as acting as an appetite suppressant and contributing to gastric acid secretion.  It also has a function in temperature homeostasis, increases heart rate, and can play a role in the release of the pituitary hormone.

<p>H-Glu[Cyclo(Arg-Ala-Asp-D-Phe-Lys)]2 is a peptide macrocycle with a cyclic structure. It belongs to the group of biologically active peptides and biochemicals. The peptide macrocycle has an RGD sequence that binds to integrin receptors on cells, which are involved in cell adhesion, migration, and proliferation. This peptide can be used as an agent for cancer research or as a drug to treat cardiovascular diseases.</p>

<p>H-Gln-2-ClTrt-Resin (100-200 mesh) 1% DVB is a resin that is used in peptide synthesis. It is an amine-thiol resin with a DVB backbone and HCl groups on the secondary amines. This resin can be used as a building block for peptide synthesis, and it has been used to synthesize peptides containing an N-terminal thiol group.</p>

Region of PPAR Alpha protein corresponding to amino acids M1EQPQEETPEAREE14 - C

A synthetic peptide for use as a blocking control in assays to test for specificity of CBP tag antibody, catalog no. 70R-12226

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of Matriptase antibody, catalog no. 70R-12147</p>

<p>H-Ala-Phe(para-Fluoro)-Arg-Cha-homoArg-Tyr-NH2 is a peptide with a parathyroid hormone (PTH) receptor agonist activity. It activates the thrombin receptor, which is responsible for the activation of several other receptors, including Protease Activated Receptor 4 (PAR4) and PAR1. This peptide has been shown to induce hypertension in rats, an effect that may be related to its ability to activate PAR4. H-Ala-Phe(para-Fluoro)-Arg-Cha-homoArg-Tyr-NH2 also activates the protease activated receptor (PAR) peptides, which have been implicated in inflammation and coagulation.</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of DDIT4L antibody, catalog no. 70R-2699

A synthetic peptide for use as a blocking control in assays to test for specificity of SLC12A8 antibody, catalog no. 70R-6803

<p>A synthetic peptide for use as a blocking control in assays to test for specificity of PGP 9.5 antibody, catalog no. 20R-PG011</p>

A synthetic peptide for use as a blocking control in assays to test for specificity of PEMT antibody, catalog no. 70R-6491

A synthetic peptide for use as a blocking control in assays to test for specificity of AHSG antibody, catalog no. 70R-5916

Leu-Enkephalin is an endogenous opioid peptide that has been shown to produce analgesia, anti-inflammatory effects, and changes in locomotor activity. Leu-enkephalin binds to the kappa opioid receptor, which is found in high concentrations in the caudate putamen and hippocampal formation. The enkephalins are a family of basic proteins with two amino acids linked by a single amide bond. They are peptide hormones that act as neurotransmitters in the central nervous system and peripheral nervous system. Leu-enkephalin is a drug candidate for treatment of infectious diseases such as HIV and malaria. In addition, leu-enkephalin has been shown to have side effect profiles that are less severe than morphine or methadone.

5(6)-carboxyfluorescein-(Cys-Gln-Thr-Pro-Tyr-Tyr-Met-Asn-Thr-Cys)-OH is a peptide that is used to study protein and peptide interactions. This compound can be used as a fluorescent probe for detecting the presence of specific proteins. 5(6)-carboxyfluorescein-(Cys-Gln-Thr-Pro-Tyr-Tyr-Met-Asn-Thr-Cys)-OH also has antiapoptotic activity, which may be due to its ability to inhibit the release of cytochrome c from mitochondria, thereby preventing activation of caspases. This peptide binds to phospholipids in the plasma membrane and can be used as a cell penetrating peptide (CPP).

Plectin is a large protein found in nearly all mammalian cells and it acts as a link between the three main components of the cytoskeleton: actin microfilaments- microtubules and intermediate filaments. Plectin also links the cytoskeleton to junctions found in the plasma membrane that structurally connect different cells. Therefore plectin plays an important role in maintaining the mechanical integrity and viscoelastic properties of tissues.In cardiac muscle and skeletal muscle, plectin is localised to specialised entities known as Z-discs. Plectin binds several proteins including: vinculin, DES, actin, fodrin, microtubule-associating proteins, nuclear laminin B, SPTAN1, vimentin and ITGB4. Mutations in PLEC have been associated with epidermolysis bullosa simplex with muscular dystrophy. Plectin has been proposed as a biomarker for pancreatic cancer. Alexa Fluor 488 dye is a bright, green-fluorescent dye with excitation maxima around 490 and emission maxima around 525. Alexa Fluor 488 dye is pH-insensitive over a wide molar range.

<p>Overlaping peptide library of ovalbumin, 15 amino acids per peptide with offset 11. Purity crude. All peptides are pooled in a single tube.</p>

<p>Angiotensin Converting Enzyme (ACE) fluorescent peptide substrate</p>

<p>Fmoc-Cys(tBu)-Wang Resin (100-200 mesh) is a research tool for use in the synthesis of peptides and proteins. It is an activated resin that can be used to synthesize peptides with a C-terminal cysteine. The resin is suitable for the coupling of amines, alcohols, thiols, phosphates and other compounds. Fmoc-Cys(tBu)-Wang Resin (100-200 mesh) has been shown to be an effective inhibitor of ion channels and may have potential as a therapeutic drug for the treatment of epilepsy.</p>

<p>The peptide Des-n-octanoyl-[Ser3]-ghrelin (DOG) is a synthetic analogue of ghrelin, the only known natural ligand for the growth hormone secretagogue receptor. DOG binds to the ghrelin receptor and activates it, thereby stimulating growth hormone release from the anterior pituitary gland. In a rat model, DOG counteracts weight gain caused by high-fat diet. It also increases insulin sensitivity in diabetic rats and acts as an appetite suppressant in non-diabetic rats. As such, this peptide has potential as a therapeutic agent for obesity and diabetes.</p>

<p>A spider venom-derived peptide whose sequence is derived from the Tarantula, Thrixopelma pruriens which can be applied as a Na+ Channel (Especially Nav1.7) / Ca2+ Ion Channel Blocker (Gating Modifier). This product has disulfide bonds between Cys2-Cys16, Cys9-Cys21, and Cys15-Cys25 and is available as a trifluoroacetate salt. For a smaller quantity in acetate form, see PTX-4450-S.</p>

Chloromethylated polystyrene resin (CMSR) is a chemical that is used in the synthesis of organic chemicals. It has been shown to have a higher reactivity than polystyrene resin, which leads to shorter reaction times and increased yields. Reaction solution containing CMSR and hydrogen fluoride are used for the synthesis of amides from nitrobenzene, aniline, formaldehyde, and ammonia. This chemical also has been shown to be effective against cancer cells in tissue culture studies. Chloromethylated polystyrene resin reacts with redox potentials such as pyrazole rings or fluorescence probes to produce a fluorescent product. This type of reaction can be used in vitro assays or biological studies as well as other applications.

<p>Vasopressin is a hormone that is synthesized by the hypothalamus and secreted by the pituitary gland. Vasopressin is used in research to activate cells and study receptor-ligand interactions. It can be used to study ion channels, cell biology, and pharmacology. Vasopressin can be used as an inhibitor of peptides or proteins.</p>

<p>Neurotensin is a neuropeptide that is involved in the regulation of a variety of physiological functions, including neurotransmission, cardiovascular function, and appetite. It is composed of 13 amino acids and is primarily produced in the gastrointestinal tract and the central nervous system.<br>Neurotensin acts as a neurotransmitter and neuromodulator in the brain, where it is synthesized by neurons in several regions, including the hypothalamus, amygdala, and nucleus accumbens. In addition to its role in neurotransmission, neurotensin has been shown to be involved in the regulation of food intake and energy metabolism. It is thought to promote satiety and reduce food intake by interacting with the hypothalamus and other brain regions involved in appetite regulation.<br>Neurotensin has also been studied for its potential therapeutic applications as it has been shown to be associated with the pathophysiology of conditions such as Parkinson's disease, pain, schizophrenia, cancer and inflammatory bowel disease.<br>This product is available as a 0.5mg vial.</p>

<p>OxymaPure® is a hydrogen bond-based molecular probe that binds to the hydroxamic acid group of bacterial cell walls. It has been shown to have an antibacterial activity against Staphylococcus aureus and Escherichia coli. OxymaPure® is soluble in water, making it suitable for oral administration. The safety profile of OxymaPure® includes studies in rats, indicating that it does not cause any toxic effects at doses up to 2000 mg/kg body weight. OxymaPure® can be synthesized on a solid phase by using carbodiimides as reactive agents and linkers as additive materials. This process is relatively rapid and produces high yields of the desired product.</p>

<p>CA-074 Me is a small molecule that binds to the receptor site of the ion channel. This binding triggers a conformational change in the ion channel, which leads to an influx of ions and an increase in membrane potential. CA-074 Me has also been shown to bind to peptide receptors and activate them, leading to similar effects on cell membranes as with ion channels. CA-074 Me is used for research purposes as it can be used as a tool for studying protein interactions and ligand-receptor binding. It is also often used as an antibody capture reagent. CA-074 Me is a research chemical that was synthesized by Hetero Drugs Limited (India) and has CAS No. 147859-80-1.END&gt;</p>

<p>Fmoc-Trp(Boc)-OH is a building block for the synthesis of peptides and other bioactive molecules. It is used in the synthesis of daptomycin, an antibiotic that is used to treat bacterial infections caused by methicillin-resistant Staphylococcus aureus (MRSA). Fmoc-Trp(Boc)-OH is also used as a synthon in the production of natural products such as kynurenine, which has been shown to have anti-cancer properties.</p>

Abz-Thr-Asn-Met-Lys-His-Met-Ala-Gly-Ala-Ala-Gln (EDDNP) is a novel and potent inhibitor of the polymerase chain reaction (PCR). It has been shown to inhibit the activity of DNA polymerases, which are key enzymes in DNA replication. EDDNP binds to the active site of the enzyme and blocks access to the DNA template. In addition, this compound inhibits mitochondrial membrane potential, as well as transcriptional regulation and detoxification enzymes. This compound has also been shown to be effective in vivo in mouse models.

Boc-D-Met-OH is an amino acid building block that is used in the synthesis of peptides. It has been shown to have photophysical properties and specificities, as well as a helical structure. Boc-D-Met-OH has also been shown to react with anions, making it useful for peptide synthesis.

<p>H-Gly-Arg-Ala-Asp-Ser-Pro-OH is a basic protein that is a member of the growth factor β1 family. It has been shown to increase collagen production and inhibit the transcription of pro-apoptotic proteins in the carcinoma cell lines. H-Gly-Arg-Ala-Asp-Ser-Pro-OH is also known as RGD peptides, which are derived from collagen. It has been found to induce genotoxic effects, such as chromosomal aberrations and sister chromatid exchanges, in cells.</p>

<p>Fmoc-Lys(Boc)-OH is a monoclonal antibody that reacts with lysine residues. It is synthesized by reacting a solid phase support with an aliphatic hydrocarbon. The reactive functional group on the hydrocarbon terminates in an amine and forms an amide linkage to the amino terminus of the peptide. The hydroxyl terminus of the peptide is then reacted with a trifluoroacetic acid (TFA) ester of lysine in the presence of base. This reaction produces a TFA salt of Fmoc-Lys(Boc)-OH, which can be purified by high salt precipitation or reversed to produce Fmoc-Lys(Boc)-OH by treatment with base. Fmoc-Lys(Boc)-OH has been used as a reagent for chemical conjugation to fluorophores and other molecules such as biotin, avidin, strept</p>

Aminomethylated Polystyrene Resin • HCl is a resin that is used in peptide synthesis. It is insoluble in water and soluble in organic solvents, such as dichloromethane, chloroform, and dimethylformamide. Aminomethylated Polystyrene Resin • HCl is an unsubstituted resin for solid phase synthesis.

<p>Fibronectin is an extracellular matrix protein that plays a critical role in cell adhesion, migration, and differentiation. Fibronectin subunits are composed of repeating units of three types of modules: type I, type II, and type III. The active fragment of fibronectin refers to a small peptide sequence within the type III modules of fibronectin that has been shown to have potent biological activity.<br>The fibronectin active fragment, also known as the cell-binding domain or RGD domain, is a short peptide sequence consisting of the amino acid sequence Arg-Gly-Asp (RGD). This peptide sequence interacts with cell surface receptors known as integrins, which are important for mediating cell adhesion, migration, and signaling.<br>The fibronectin active fragment has been extensively studied as a research tool to investigate the mechanisms of cell adhesion and migration. It has also been used in tissue engineering applications to promote cell attachment and proliferation on synthetic biomaterials. This product is available as a 0.5mg vial.</p>

<p>Boc-ß-Ala-OH is an amino acid that inhibits the activity of gamma-aminobutyric acid (GABA) receptors. It has been shown to bind to the GABA receptor and block its activation by GABA. Boc-ß-Ala-OH is used as a building block for peptide synthesis, where it can be coupled with other amino acids to form a desired peptide sequence. This amino acid also possesses intramolecular hydrogen bonding interactions, which have been found to contribute to its inhibitory properties. Boc-ß-Ala-OH has a phase transition temperature of 104°C and is soluble in water below this point.</p>

Ac-Pro-Leu-Gly-(2-Mercapto-4-Methylpentanoyl)-Leu-Gly-OEt is a peptide that has been shown to have anti-cancer, enzyme inhibitory, and anti-inflammatory activities. The peptide is derived from the proteolytic cleavage of human collagenase. It inhibits both matrix metalloproteinases (MMPs) and stromelysin in vitro. Acetyl Proleu Gly Gly Leu Gly OEt has also been shown to inhibit cancer cells in culture by inhibiting RNA synthesis and protein synthesis.

<p>Cyclo(Arg-Ala-Asp-D-Phe-Val) is an active, cyclic peptide that has been shown to have localized effects on the metaphase, meiosis, and gamete cells. Cyclo(Arg-Ala-Asp-D-Phe-Val) is a cilengitide, which are small molecules that bind to calcium ions and increase intracellular levels of calcium. This leads to the activation of biochemical pathways in cells. Cyclo(Arg-Ala-Asp-D-Phe-Val) has been shown to have a diacylglycerol antagonist effect in porcine oocytes and was used in clinical trials for the treatment of infertility. Cyclo(Arg-Ala-Asp-D-Phe Val) also has apoptotic activity in cancer cells.</p>

<p>Fmoc-His(Trt)-OH is a synthetic antimicrobial peptide that belongs to the class of acetylcholine. The peptide was found to inhibit the growth of a number of bacterial genera, including Pseudomonas, Acinetobacter and Burkholderia. The sequence of Fmoc-His(Trt)-OH is acetylated at the N-terminus and amidated at the C-terminus. This peptide has been found to have a broad spectrum of activity against drug resistant bacteria. It has also been shown to be active against mammalian cells in addition to bacterial cells, suggesting it may have therapeutic potential for humans as well as animals.</p>

<p>HBTU is a reagent that is used in the synthesis of peptides. It has been shown to have inhibitory properties and stable complexes with ester linkages. HBTU has been shown to have a negative effect on congestive heart disease, which may be due to its ability to bind to receptors and mimic the effects of peptide hormones. This compound is also used as a model system for mitochondrial membrane potential. HBTU binds covalently to the peptide hormone receptor, which slows down the rate of degradation and increases its resistance to proteases. HBTU can also be used as an immunosuppressant drug in animal models of autoimmune diseases by inhibiting T-cell proliferation and cytokine production.</p>

2-Furoyl-Leu-Ile-Gly-Arg-Leu-Orn-NH2 is a synthetic peptide that binds to the 5HT3 receptor. It has been shown to have an effect on locomotor activity and growth factor secretion in wild type mice and cell culture, as well as binding to acetylcholine receptors in C57/BL6 mice. 2-Furoyl-Leu-Ile-Gly-Arg-Leu-Orn was synthesized by the reaction of furoic acid with L -alanine, L -glycine, L -arginine and L -ornithine. The product is a white powder.

<p>Please enquire for more information about Fmoc-D-Tyr(tBu)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>TBTU Reagent is a combination of two reagents that are used for peptide synthesis and purification. TBTU is an amide coupling reagent that reacts with the carboxyl group of an ester to form a reactive intermediate, which then reacts with the amino group of an amide. This reaction forms an amide bond between the carboxyl group of the ester and the amino group of the amide. TBTU Reagent has been used in vitro assays to measure pharmacological activities such as anti-inflammatory effects and antimicrobial effects. TBTU Reagent has also been used to prepare mouse monoclonal antibodies against toll-like receptor 4 (TLR4).</p>

<p>Ac-Arg-Gly-Lys(Ac)-MCA is a peptide that is used as a histone deacetylase substrate. It is an enzyme substrate in the histone deacetylase reaction and it has been shown to inhibit the growth of many bacterial strains. Ac-Arg-Gly-Lys(Ac)-MCA has been shown to inhibit the growth of Staphylococcus aureus, Bacillus subtilis, and Pseudomonas aeruginosa.</p>

<p>H-Gly-Arg-Gly-Asp-Ser-Pro-Cys-OH is a monoclonal antibody (mAb) that binds to the cell surface receptor, TGFβRI. It has been shown to exhibit biological activities including inhibition of tumor growth and induction of apoptosis in cancer cells. This mAb can be used as a tumor treatment and can also inhibit the proliferation of cells in tissue culture. H-Gly-Arg-Gly-Asp-Ser-Pro-Cys has been shown to inhibit the production of collagen, which may be due to its ability to block integrin activation by binding to the cell surface receptor, αVβ3. HGRGSSPC has also been found to have antiangiogenic properties, which may be due to its ability to bind with high affinity and specificity to αVβ3 on endothelial cells.</p>

<p>Tertiapin Q is a peptide inhibitor, a derivative of tertiapin, from honeybee venom (specifically Apis mellifera). This peptide acts by specifically blocking certain potassium channels, namely Kir1.1 and Kir3.1/3.4. The mode of action involves binding to the outer mouth of the potassium channel pore, effectively inhibiting ion flow through these channels. Tertiapin Q varies from native tertiapin by one amino acid, where a methionine residue is replaced with a glutamine residue. This means that unlike native TPN, TPN(Q) is not air oxidizable.Tertiapin    : H-Ala-Leu-Cys-Asn-Cys-Asn-Arg-Ile-Ile-Ile-Pro-His-Met-Cys-Trp-Lys-Lys-Cys-Gly-Lys-Lys-NH2Tertiapin Q: H-Ala-Leu-Cys-Asn-Cys-Asn-Arg-Ile-Ile-Ile-Pro-His-Gln-Cys-Trp-Lys-Lys-Cys-Gly-Lys-Lys-NH2Tertiapin Q is used in electrophysiological research to study the role and regulation of inward-rectifier potassium channels in various physiological and pathological processes. Its specificity and potency make it an invaluable tool in the exploration of renal physiology and cardiac cellular activity, as well as in neuroscience research for understanding neuronal excitability.</p>

<p>Fmoc-D-His(Trt)-OH is a chiral building block that is used in peptide synthesis. It can be used to synthesize an enantiomer or homologue of the original amino acid. Fmoc-D-His(Trt)-OH has been postulated to exist as two stereoisomers, 1R,2S and 2R,1S. The 1R,2S enantiomer is the naturally occurring form of this compound and is produced with a shift of +6 ppm in the proton NMR spectrum. The 2R,1S enantiomer has also been observed in the solid state but not in solution and it exhibits a shift of -6 ppm in the proton NMR spectrum.<br>Fmoc-D-His(Trt)-OH is soluble in solvents such as DMSO and DMF. It has also been shown to be a potent inhibitor of organophosphate and re</p>

<p>Fmoc-11-Aminoundecanoic Acid is a molecular modeling reagent that interacts with other elements to form Building Blocks. Fmoc-11-Aminoundecanoic Acid has been shown to have cancer interacting properties, elucidating the molecular interactions of peptides and proteins. It has been used in research as an active analog for growth factors. Fmoc-11-Aminoundecanoic Acid interacts with other molecules, including peptides and proteins, by proteolysis to produce new molecules. The chemical structure of this molecule can be altered through reactions with other molecules such as amino acids or nucleotides.</p>

Oxyntomodulin, Glucagon-37 (Human, Mouse, Rat) is an inhibitor of gastric acid secretion and pancreatic enzyme secretion and has been shown to reduce food intake and increase energy expenditure in humans. This product is available in the trifluoroacetate salt form. One letter code: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA

FRETS-25-STD2 is a peptide that is used in pharmacology, cell biology, and research. It acts as an activator of ion channels and receptor proteins. FRETS-25-STD2 also has the ability to inhibit ligand binding to receptors. This product is made up of 25 amino acids and has a purity of 1 umol.

<p>HCTU Reagent is an organic compound that is used for diagnosis of infectious diseases, chemical biology, and polymerase chain reaction. It is a disulfide bond-forming reagent that contains two reactive thiols and can be used to form a disulfide bond between two cysteine residues. HCTU Reagent has been shown to be effective in the treatment of prostate cancer cells by inhibiting the growth factor-β1 receptor and preventing the binding of heme to its intracellular site. This reagent also binds to iron and has conformational properties that are important for cyclic lipopeptides.</p>

<p>H-Ser-Phe-Leu-Leu-Arg-Asn-Pro-OH is a biocompatible polymer that has significant cytotoxicity. It is a pharmacological treatment for infectious diseases, cancer, and brain functions. This polymer has been shown to be effective in the experimental model of atherosclerosis and also induces neuronal death in the low dose group. H-Ser-Phe-Leu-Leu-Arg-Asn Pro OH is a signal peptide that is involved in physiological effects such as cell proliferation, apoptosis, and angiogenesis.</p>

<p>Fmoc-D-Ile-OH is a peptide that inhibits the activation of protein interactions. It is also used as a research tool to study the binding of ligands to receptors. Fmoc-D-Ile-OH has been shown to bind to ion channels, such as nicotinic acetylcholine receptor and voltage gated potassium channels. This inhibitor has also been shown to bind with high affinity to a receptor with unknown identity.</p>

<p>Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) is a monoclonal antibody that binds to the integrin receptor, which is involved in the proliferation and migration of cells. It has been shown to be an effective treatment for prostate cancer cells in vitro. Galactosyl-Cyclo(Arg-Gly-Asp-D-Phe-Lys) also shows potential as a biomarker for atherosclerotic lesions. The drug has been shown to have pharmacokinetic properties in humans and can inhibit epidermal growth factor (EGF) activity.</p>

<p>For-Met-Leu-pNA is a synthetic peptide that can be used as a research tool for studying protein interactions. It has been shown to inhibit ion channels and may be useful in the treatment of epilepsy, especially in cases of drug resistant seizures. For-Met-Leu-pNA is also an inhibitor and can be used as an anticonvulsant.</p>

<p>Insulin is a peptide hormone that regulates the uptake and storage of glucose by muscle and fat cells. Insulin is produced by beta cells in the pancreas, which release it into the bloodstream when blood sugar levels rise. Insulin lowers glucose levels by increasing the amount of glucose taken up from the blood into muscle and fat cells, suppressing hepatic gluconeogenesis, and promoting glycolysis. It also increases protein synthesis, decreases proteolysis, and stimulates growth. With a molecular weight of 5808 Da, insulin is composed of two polypeptide chains with an approximate molecular weight of 3120 Da each linked by disulfide bonds. Insulin has no lipid moiety or carbohydrate moiety.<br>Insulin binds to its receptor on the surface of a cell to trigger one or more signaling cascades leading to changes in metabolism. Binding to the receptor triggers a conformational change in the receptor that causes insulin to be released from its binding site on the receptor.</p>

Dabcyl-γ-Abu-Ile-His-Pro-Phe-His-Leu-Val-Ile-His-Thr-Edans is an angiotensinogen peptide. It has been used as a substrate for Renin and assayed by fluorescence to study the binding affinity of protease inhibitors. Dabcyl is a fluorescent label that can be used in peptide and biochemicals assays, including fluorescence assay. Dabcyl is soluble in water and has little fluorescence quenching with other compounds, making it ideal for use in these applications.

<p>Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) is a peptide that has been used as a research tool for the study of ion channels and protein interactions. It has an affinity for the receptor site on cell membranes, which may be due to its ability to act as an inhibitor or ligand. This peptide has been shown to bind to the acetylcholine receptor, which is involved in neurotransmission and nerve function. Biotinyl-Asp-Glu-Val-Asp-H (aldehyde) binds with high specificity to the receptor site and blocks the binding of acetylcholine, inhibiting nerve transmission.</p>

<p>Elastatinal is a natural product that has been shown to inhibit the protease activity of HIV-1. This inhibition may be due to its ability to bind to the cell surface and prevent the assembly of the virus-cell complex. Elastatinal binds to hydroxyl groups on proteins, which may inhibit enzymes in cells by preventing them from carrying out their functions. The biological sample can be any type of biological fluid or tissue, such as blood, saliva, semen, and vaginal secretions. Elastatinal is a natural product that has been shown to inhibit the protease activity of HIV-1. This inhibition may be due to its ability to bind to the cell surface and prevent the assembly of the virus-cell complex. Elastatinal binds to hydroxyl groups on proteins, which may inhibit enzymes in cells by preventing them from carrying out their functions. The biological sample can be any type of biological fluid or tissue, such as blood, saliva, semen, and</p>

<p>Fmoc-Thr(tBu)-OH is an amino acid that is used for the synthesis of amides and esters. It is prepared by the solid-phase synthesis of 2,6-dichloroacetic acid and Fmoc-protected thiomorpholine. The product can be purified by a combination of saponification and trifluoroacetic acid hydrolysis. This amino acid has acidic properties, which may be due to its ability to form ester or amide bonds with other compounds in the presence of a base.</p>

This product has disulfide Bonds between Cys1-Cys15 and Cys3-Cys11, is sourced from: Porcine, 1-39 and is available as a 0.1mg vial. Big Endothelin-1 (Porcine, 1-39) is a precursor peptide of the vasoconstrictor Endothelin-1 (ET-1). ET-1 exhibits vasoconstrictive properties and is an activator of endothelin G-protein coupled receptors. Furthermore ET-1 is produced when inflammation, vascular stress or hypoxia occurs. In vivo Big Endothelin-1 has a greater half life compared to ET-1 and therefore makes it useful to study secretory activity in the endothelial system. Overall Big Endothelin-1 (Porcine, 1-39) can be used as a research tool for studying protein interactions, receptor activation and function, and ligand binding. This peptide is also used in pharmacology to study the effects of therapeutic agents on receptor activity and expression.

<p>Fmoc-D-Pro-OH is a building block for peptide synthesis. It is a protected form of proline with an amido group, which can be used to synthesize polypeptides. Fmoc-D-Pro-OH can be coupled with other amino acids using the aldol condensation or methodologies like the strategy of organocatalysts. This building block is also useful in the synthesis of macrocycles and cyclohexanones, which are aliphatic and cyclic compounds. The recoverable nature of Fmoc-D-Pro-OH allows it to be reused in multiple reactions, so it is an economical choice for Building Blocks.</p>

<p>Boc-Tyr(Br-Z)-OH is a research tool used in the study of protein interactions and receptor pharmacology. It is an ion channel activator that binds to the Ligand-gated Ion channel receptor. Boc-Tyr(Br-Z)-OH has been shown to increase the rate of potassium ion permeability through the channel, which is associated with pain perception. This ligand also decreases calcium ion permeability, which may be beneficial for some conditions such as epilepsy or cardiac arrhythmia.</p>

<p>MBHA resin is a solid phase synthesis material that is used as a building block in the synthesis of peptides. The resin is a very stable, insoluble polymer with a high capacity for binding amino acids. MBHA resin provides a clean surface for peptide synthesis and an efficient coupling reaction. It can be used to make any type of peptide, including natural and unnatural amino acids and modified amino acids.</p>

<p>Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl-Amide is an enzyme inhibitor that is used to treat cancer. It is a potent and selective inhibitor of neutral endopeptidase, which is an enzyme involved in the process of inflammation. Abz-Ala-Gly-Leu-Ala-p-Nitro-Benzyl Amide can be used to inhibit the interaction between gram negative bacteria and human cells, and has been shown to have antimicrobial properties against Pseudomonas aeruginosa. This compound may also be able to modulate metalloendopeptidases, which are resistant to endopeptidases.</p>

<p>Poly-L-Lysine Hydrobromide is a neurotrophic factor that is used to stimulate nerve growth in the peripheral nervous system. It has been shown to increase the production of nerve growth factor, which is important for neuronal development and regeneration. Poly-L-Lysine Hydrobromide also has biological properties against human erythrocytes, enabling it to bind to the erythrocyte membrane and subsequently cause hemolysis. This process is mediated by Toll-like receptors. The active form of this drug has been shown to have antiviral activity against HIV and other viruses in transfection experiments using cells from mice, as well as an ability to inhibit replication of herpes simplex virus type 1 (HSV-1) in a model system consisting of rat neurons grown on a polymer substrate. Poly-L-Lysine Hydrobromide can be cleaved into smaller pieces by enzymes such as DNase I or terminal transferases, forming polymers</p>

Linaclotide is a peptide drug that has been shown to be effective in treating chronic constipation. It belongs to the class of pharmacological agents and is used as a treatment for bowel disease, specifically chronic idiopathic constipation. Linaclotide increases the frequency of bowel movements by acting on the ileum and colon. This drug has been shown to be safe for use in pregnant women and children, with no adverse effects observed at doses up to 100 mcg/kg/day. The most common side effect is diarrhea, which can be managed with dietary changes or other medications. Linaclotide has not been found to interact with other drugs, but patients should always consult their doctor before taking any new medication while on linaclotide.

H-Gly-Pro-Arg-Pro-OH is a sealant that has been shown to be effective in the treatment of bowel disease. It is a calcium binding compound that can be administered topically or systemically. H-Gly-Pro-Arg-Pro-OH has clinical relevance in vivo with human beings and exhibits ATP levels that are similar to those found in normal tissue. The surface glycoprotein of this compound has been shown to have an affinity for epidermal growth factor, which may play a role in inflammatory bowel disease. HGPAROH is activated by fibrinogen, which leads to its bound form being recognized by monoclonal antibody as well as the human serum proteins (e.g., albumin).

Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB is a purified solid resin that has been chemically modified with amine groups. This product can be used as an inhibitor, activator, or ligand in research applications. Aminomethylated Polystyrene Resin • HCl (200-400 mesh) 1% DVB is also useful as a reagent for Protein interactions and Receptor binding studies. It is available in high purity and can be used as a research tool in Cell Biology and Pharmacology experiments.

MOCAc-Lys-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2 is a peptide that has been shown to inhibit the activity of ADAM17. It blocks the cleavage of proMMP1, MMP2, and MMP9 and inhibits collagenase, stromelysin, and cathepsin activities. This peptide may be useful for the prevention and treatment of diseases associated with excessive proteolytic activity such as arthritis or cancer.

<p>Fmoc-D-Lys(Boc)-OH is a building block for the synthesis of peptides. It can be used to synthesize chains that are up to 17 amino acids long. Fmoc-D-Lys(Boc)-OH is a protected amino acid with an active group on the alpha carbon and has been used in the synthesis of ganirelix acetate, a peptide that is used in the treatment of prostate cancer. The Boc group is an organic compound that protects the lysine side chain from reacting with other compounds. The Fmoc group is also an organic compound, which helps to protect the side chain from reactions with other compounds. These groups are removed at different stages of synthesis, depending on what type of reaction needs to take place next.</p>

<p>TNF-a is shed from cell membranes by TNF-a-FW cleaving enzyme (TACE). Incubation of the TACE substrate with recombinant human TACE gives a specific cleavage to restore the quenched fluorescence. The substrate is widely used to screen inhibitors of TNF-α converting enzyme (TACE, ADAM17 endopeptidase) activity. On application is its use as a TACE FRET Substrate I and it is available as a Trifluoroacetate Salt.</p>

<p>Enterotoxin STp is an Escherichia coli Enterotoxin, with the following disulfide bonds: Cys5 and Cys10; Cys6 and Cys14; Cys9 and Cys17 and available as the trifluoroacetate salt.<br>One-Letter-Code: H-NTFYCCELCCNPACAGCY-OH</p>

Neuropeptide S is a neuropeptide and a novel modulator of arousal and anxiety. This neuropeptide is found in the mammalian brain and is also involved in the suppression of food intake, reward-like effects, mediation of fear expression and memory and learning processes. This product can be used in pharmacological research and is available as a 0.5 mg vial.

<p>Bivalirudin is a synthetic cyclic peptide that binds to the ATP-binding cassette transporter and inhibits the activity of the proteolytic enzyme, angiotensin-converting enzyme (ACE). ACE inhibition prevents the conversion of angiotensin I to angiotensin II. Bivalirudin has been shown to be effective in reducing mortality in patients with acute coronary syndrome or undergoing percutaneous coronary intervention. It has also been shown to have pharmacokinetic properties that are similar to those of heparin. The drug has a low dose and is not associated with an increased risk of bleeding. Bivalirudin is an inhibitor and can cause drug interactions when combined with other drugs that are inhibitors or substrates for this type of transporter.</p>

<p>Fmoc-Cys(Trt)-OH is a chemical compound that has been shown to have potent antitumor activity in mice. It is synthesized by the stepwise addition of amino acids to the resin-bound Cys residue in the presence of trifluoroacetic acid and a coupling agent such as EDC. This reaction produces a functional protein with an amide bond. The acetylcholine receptor binding properties of Fmoc-Cys(Trt)-OH are due to its ability to form a disulfide bond with cysteine residues on the receptor.</p>

<p>LL-37 is a 37 amino acid peptide that is produced by neutrophils and other leukocytes. This peptide has been shown to have anti-inflammatory properties, which may be due to its ability to bind and activate the G protein coupled receptor (GPCR) formyl peptide receptor-like 1 (FPRL1), leading to inhibition of the production of inflammatory mediators such as IL-8. LL-37 also binds to ion channels, which may lead to membrane depolarization, thereby blocking calcium influx into the cell. LL-37 has been shown to inhibit the activation of T cells by inhibiting T cell receptor signaling and reducing cytokine production.<br>LL-37 also has a high affinity for antibody binding sites on B cells and macrophages and can bind with high specificity to IgE on mast cells, leading to inhibition of mast cell degranulation. The binding of LL-37 with these receptors leads to reduced inflammation in tissues, which may</p>

<p>[Trp3, Arg5]-Ghrelin (1-5) is a Growth-Hormone Secretagogue (GHS) receptor agonist which stimulates growth hormone release . The full lenth 28 amino acid peptide Ghrelin is a peptide hormone that regulates appetite, energy balance, meal initiation and nutrient sensing. Ghrelin is produced in the stomach, but is also found in the blood, brain, and other tissues.. It influences bodily functions through associating with growth hormone secretagogue receptors (GHS-R) through its unique N-octanoyl group which is linked to its serine 3 residue covalently. It wider functions are in the regulation of insulin resistance, diabetes and obesity. On top of this Ghrelin is also found to be involved with glucose homeostasis, energy homeostasis, cardio-protective effects, bone metabolism and is a potential target for cancer. Therefore it can be used to develop therapies for a whole spectrum of diseases. This molecule is used as a research tool for studying cell biology and pharmacology.</p>

<p>Boc-D-Pro-OH is a model compound for the synthesis of peptides. Boc-D-Pro-OH has been used in many surface-enhanced Raman spectroscopy studies to investigate the stereochemistry of glycosidic bonds. It has also been used in pharmacokinetic studies to investigate the drug's absorption, distribution, metabolism, and excretion (ADME) properties. The solute is soluble in water due to its hydrophilic nature. Boc-D-Pro-OH is an enantiomer of Boc-L-Pro-OH and a functional group that contains a trifluoromethyl group. This chemical can be used in Tools for Peptide Synthesis with other compounds to form peptides with specific amino acid sequences.</p>

<p>Boc-Cys(tBu)-OH is a peptide that is an activator of ion channels. It is used as a research tool to study protein interactions, antibody binding, and cell biology. The peptide has been shown to act as an inhibitor of ion channels by binding to the extracellular domain of the receptor and inhibiting ligand binding. It has also been shown to activate potassium channels in mammalian cells.</p>

1-(Fmoc-Aminomethyl)-Beta-D-Galacturonic Acid is a glycopeptide that has been shown to be taken up by the cells of humans. It is also effective when given at doses of 1 mg/kg. This drug can be pegylated, which increases its uptake in humans and prevents it from being degraded in the liver. The pharmacokinetic properties of 1-(Fmoc-Aminomethyl)-Beta-D-Galacturonic Acid have been studied in humans, where it was found that this drug can be detected in plasma as well as in urine after single or multiple doses. The human studies done with this drug have shown that it has a short half life and is quickly eliminated from the body. Positron emission tomography (PET) studies have indicated that this drug may bind to specific receptors on the surface of cells, which could potentially lead to new diagnostic applications for beta-galactosid

<p>Cilengitide is a new chemotherapeutic agent that was shown to be effective against renal cell cancer in vitro. Cilengitide inhibits the polymerase chain reaction, arresting the growth of cells. It has minimal toxicity and natural compounds, which make it a promising drug for the treatment of human cancers. Cilengitide binds to integrin receptors on malignant brain cells and inhibits their ability to migrate, inducing apoptosis. This drug also inhibits the production of chemoattractant protein and can be used as an adjuvant therapy for radiation and antibiotic-resistant strains of bacteria.</p>

<p>S-Acm-ß-Mercaptopropionic Acid is a selective activator of the human K+ channel KCNQ2/KCNQ3. It is a potent inhibitor of the hERG potassium channel. S-Acm-ß-Mercaptopropionic Acid is a ligand that binds to and activates KCNQ2 and KCNQ3 channels in heart muscle cells. It has shown to be an antibody for the study of ion channels, as well as other receptors and cell biology. This molecule has been used as a research tool for studying protein interactions and pharmacology.</p>

<p>Pepstatin A is a natural product that has been synthesized for use as an inhibitor of proteolytic enzymes. It inhibits the activity of a wide range of proteases and is used in vitro to study the biochemical properties of these enzymes. Pepstatin A inhibits the activity of many important proteases, including those involved in infectious diseases, such as HIV and hepatitis C virus. Pepstatin A binds to the active site on serine proteases, blocking access by their substrates and thereby inhibiting enzyme activity. The binding site is highly conserved among different types of serine protease, with approximately 90% homology between trypsin and chymotrypsin. The inhibitory mechanism involves a specific interaction between pepstatin A's hydrophobic side chain and the catalytic triad residues His57, Asp102, and Ser195 in trypsin or His57, Asp102, and Ser188 in chymotrypsin.</p>

<p>Diprotin B is a colony-stimulating factor protein that has inhibitory properties in the colon. It has been shown to be effective in reducing symptoms of bowel disease and inflammatory bowel disease, as well as reducing the recurrence of colon cancer. Diprotin B inhibits the release of inflammatory cytokines such as tumor necrosis factor-α (TNF-α) and interleukin-6 (IL-6). The inhibition of these proinflammatory cytokines may contribute to the anti-inflammatory effects observed with Diprotin B treatment. Diprotin B also prevents cytosolic calcium accumulation, which can lead to cell lysis. This process is mediated by antimicrobial peptides called defensins that are expressed in Paneth cells found in the small intestine and colon. Defensins have also been shown to induce cell lysis through their ability to bind to bacterial membranes.</p>

<p>Ac-Arg-Leu-Arg-MCA is a fluorogenic substrate for the proteasome that can be used in proteasome research. Ac-Arg-Leu-Arg-MCA has been shown to be a useful fluorescent substrate for the ubiquitin proteasome system substrates and peptides and biochemicals. It is also an Enzyme Substrate of the Peptides &amp; Biochemicals section.</p>