Prodotti biochimici e reagenti
I biochimici e i reagenti sono sostanze fondamentali per la ricerca e lo sviluppo in campi come la biotecnologia, la biologia molecolare, la farmacologia e la medicina. Questi prodotti sono essenziali per una varietà di applicazioni, tra cui la sintesi di composti, l'analisi di campioni biologici, la ricerca sui processi metabolici e la produzione di farmaci. Presso CymitQuimica offriamo un'ampia selezione di biochimici e reagenti di alta qualità e purezza, adatti a diverse esigenze scientifiche e industriali. Il nostro catalogo include enzimi, anticorpi, acidi nucleici, amminoacidi e molti altri prodotti, tutti progettati per supportare i ricercatori e i professionisti nei loro progetti di ricerca e sviluppo, garantendo risultati affidabili e riproducibili.
Sottocategorie di "Prodotti biochimici e reagenti"
- Biomolecole(99.205 prodotti)
- Per obiettivo biologico(99.900 prodotti)
- Per uso/effetti farmacologici(6.790 prodotti)
- Composti relativi alla crioconservazione e crioconservanti(21 prodotti)
- Disinfettanti, additivi per fluidi per bagni di riscaldamento e composti correlati(28 prodotti)
- Ormoni(346 prodotti)
- Biologia vegetale(6.835 prodotti)
- Metaboliti secondari(14.345 prodotti)
Trovati 130607 prodotti di "Prodotti biochimici e reagenti"
Ordinare per
Purezza (%)
0
100
|
0
|
50
|
90
|
95
|
100
Phosphatase Substrate
<p>Catalogue peptide; min. 95% purity</p>Formula:C33H65N12O11PPeso molecolare:836.95 g/mol[D-Ala2]-beta-Casomorphin (1-3) amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C21H26N4O4Peso molecolare:398.47 g/mol[D-Ala2] Deltorphin II
<p>Catalogue peptide; min. 95% purity</p>Formula:C38H54N8O10Peso molecolare:782.90 g/molbeta-Amyloid (1-28)
<p>Catalogue peptide; min. 95% purity</p>Formula:C145H209N41O46Peso molecolare:3,262.53 g/molbeta-Amyloid (30-16)
<p>Catalogue peptide; min. 95% purity</p>Formula:C86H126N24O21S2Peso molecolare:1,896.22 g/molProlactin Releasing Peptide (1-31), bovine
<p>Catalogue peptide; min. 95% purity</p>Formula:C157H244N54O41SPeso molecolare:3,576.01 g/molMBP (90-106), phosphorylated
<p>Catalogue peptide; min. 95% purity</p>Formula:C89H141N25O22Peso molecolare:1,913.27 g/mol[Tyr0] Gastric Inhibitory Peptide (23-42), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C119H182N34O31Peso molecolare:2,584.92 g/molHuman IgE Pentapeptide HEPP
<p>Catalogue peptide; min. 95% purity</p>Formula:C22H36N8O11Peso molecolare:588.58 g/molCEA Related, QYSWFVNGTF
<p>Catalogue peptide; min. 95% purity</p>Formula:C61H77N13O16Peso molecolare:1,248.37 g/mol[Ala4]-MBP (1-11)
<p>Catalogue peptide; min. 95% purity</p>Formula:C49H81N21O17Peso molecolare:1,236.32 g/molChorionic Gonadotropin-beta(109-119) amide (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C51H76N16O21SPeso molecolare:1,269.31 g/molp34cdc2-derived peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C62H104N16O19Peso molecolare:1,377.62 g/molGalanin-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C155H237N46O46SPeso molecolare:3,511.95 g/molF1 Peptide, lobster
<p>Catalogue peptide; min. 95% purity</p>Formula:C48H75N17O11Peso molecolare:1,066.24 g/molMARCKS PSD-Derived Peptide, PKC Substrate
<p>Catalogue peptide; min. 95% purity</p>Formula:C75H122N20O15Peso molecolare:1,543.93 g/molAngiotensin II Receptor, AT2, Amino Terminal Fragment
<p>Catalogue peptide; min. 95% purity</p>Formula:C79H125N23O28SPeso molecolare:1,877.08 g/mol[Ile-Ser]-Bradykinin (T-Kinin)
<p>Catalogue peptide; min. 95% purity</p>Formula:C59H89N17O14Peso molecolare:1,260.47 g/molNeuropeptide EI-Gly-Arg-Arg-MCH (human, mouse, rat)
<p>Catalogue peptide; min. 95% purity</p>Formula:C182H282N54O52S4Peso molecolare:4,186.86 g/molα-CGRP (33-37) (canine, mouse, porcine, rat)
<p>Catalogue peptide; min. 95% purity</p>Formula:C22H32N6O8Peso molecolare:508.54 g/molForkhead derived peptide, Woodtide
<p>Catalogue peptide; min. 95% purity</p>Formula:C68H123N21O20SPeso molecolare:1,586.93 g/mol[Arg8]-Vasotocin
<p>Catalogue peptide; min. 95% purity</p>Formula:C43H67N15O12S2Peso molecolare:1,050.23 g/mol[D-Tyr11]-Neurotensin
<p>Catalogue peptide; min. 95% purity</p>Formula:C78H121N21O20Peso molecolare:1,673 g/mol[Pyr6]-Substance P (6-11)
<p>Catalogue peptide; min. 95% purity</p>Formula:C36H49N7O7SPeso molecolare:723.91 g/molbFGF Inhibitory Peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C36H53N11O11Peso molecolare:815.89 g/molbeta-Amyloid (22-35)
<p>Catalogue peptide; min. 95% purity</p>Formula:C59H102N16O21SPeso molecolare:1,403.63 g/molPonatinib HCl
CAS:<p>BCR-ABL1 tyrosine kinase inhibitor</p>Formula:C29H27F3N6O·HClPurezza:Min. 95%Peso molecolare:569.02 g/molAquaporin-2 (254-267), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C69H116N24O22Peso molecolare:1,633.84 g/mol[D-Pro194]-IL-1 beta (193-195) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C15H28N4O5Peso molecolare:344.41 g/mol[Val35] -beta-Amyloid (1-42)
<p>Catalogue peptide; min. 95% purity</p>Formula:C203H311N55O60Peso molecolare:4,481.96 g/molGRF, porcine
<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>Formula:C219H365N73O66SPeso molecolare:5,108.86 g/molDynorphin A (7-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C65H108N22O16Peso molecolare:1,453.72 g/molBiotin-RR-SRC, Insulin Receptor Tyrosine Kinase Substrate
<p>Catalogue peptide; min. 95% purity</p>Peso molecolare:1,745.99 g/molBAM-12P, Bovine Adrenal Medulla Docosapeptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C62H97N21O16S1Peso molecolare:1,424.66 g/molHIV-gp41-Antigenic Peptide 5
<p>Catalogue peptide; min. 95% purity</p>Formula:C184H282N56O53S2Peso molecolare:4,190.77 g/molα-Neo-Endorphin Analog
<p>Catalogue peptide; min. 95% purity</p>Formula:C66H102N20O13Peso molecolare:1,383.68 g/molAGRP (87-132), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C219H339N65O63S11Peso molecolare:5,243.17 g/molHC-067047
CAS:<p>HC-067047 is an experimental drug that has been shown to decrease the intracellular Ca2+ concentration in various cell types, including neurons. This agent also inhibits the influx of Ca2+ ions through voltage-gated channels and blocks the release of Ca2+ from intracellular stores. HC-067047 is being investigated for chronic cough as it has been shown to reduce this symptom in a guinea pig model of asthma. In vitro studies have shown that HC-067047 is not active against protozoa or bacteria but does inhibit the growth of tumor cells. The mechanism of action for HC-067047 is not fully elucidated, but it may act by inhibiting ion transport proteins such as TRPV4, Toll-like receptor, or Ryanodine receptor. HC-067047 has also been found to increase MMP9 activity and inhibit production of cytokines such as IL-6 and TNFα.</p>Formula:C26H28F3N3O2Purezza:Min. 95%Peso molecolare:471.51 g/mol[Cys0]-GTP-Binding Protein Gsa (28-42)
<p>Catalogue peptide; min. 95% purity</p>Formula:C85H143N30O24SPeso molecolare:2,001.29 g/molFMRF amide Molluscan Cardioexcitatory Peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C29H42N8O4SPeso molecolare:598.76 g/molEGF Receptor (988-993) (phosphorylated) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C31H46N7O16PPeso molecolare:804.7 g/molCecropin P1 (porcine)
<p>Catalogue peptide; min. 95% purity</p>Formula:C147H253N46O43Peso molecolare:3,338.93 g/molCDC25C
<p>Catalogue peptide; min. 95% purity</p>Formula:C115H198N40O33SPeso molecolare:2,701.17 g/molBand 3 Protein (547-553) (human)
CAS:<p>Please enquire for more information about Band 3 Protein (547-553) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C41H63N11O11Peso molecolare:886.02 g/moltert-Butyi-(1R, 5S)-2-amino edoxaban oxalate
CAS:<p>Please enquire for more information about tert-Butyi-(1R, 5S)-2-amino edoxaban oxalate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H29N3O7Purezza:Min. 95%Peso molecolare:375.42 g/molSecretin-Lys(Biotin), human
<p>Catalogue peptide; min. 95% purity</p>Formula:C130H220N44O40Peso molecolare:3,039.4 g/mol9''-Methyl salvianolate B
CAS:<p>9''-Methyl salvianolate B is a naturally derived phenolic acid compound, specifically a methylated derivative, extracted from the roots of Salvia miltiorrhiza. This plant, commonly known as Danshen, is widely used in traditional Chinese medicine. The compound’s primary source involves a meticulous extraction and purification process aimed at isolating its bioactive constituents.</p>Formula:C37H32O16Purezza:Min. 95%Peso molecolare:732.65 g/molPRRS-PQGAB-M
<p>Catalogue peptide; min. 95% purity</p>Formula:C53H80N16O23Peso molecolare:1,309.32 g/mol[D-Trp8,D-Cys14]-Somatostatin-14
<p>Catalogue peptide; min. 95% purity</p>Formula:C76H104N18O19S2Peso molecolare:1,637.91 g/molbeta-Interleukin II (44-56)
<p>Catalogue peptide; min. 95% purity</p>Formula:C68H113N19O19Peso molecolare:1,500.77 g/molInsulin-like Growth Factor I (57-70)
<p>Catalogue peptide; min. 95% purity</p>Formula:C65H104N15O23SPeso molecolare:1,495.7 g/molbeta-MSH, porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C98H138N26O29SPeso molecolare:2,176.36 g/mol[Tyr1]-pTH (1-34) (rat)
<p>Catalogue peptide; min. 95% purity</p>Formula:C186H295N55O49S2Peso molecolare:4,149.86 g/molPRRS-PQGAB-N
<p>Catalogue peptide; min. 95% purity</p>Formula:C54H76N12O24SPeso molecolare:1,309.33 g/molMelanotan II, MT-Ⅱ
<p>Catalogue peptide; min. 95% purity</p>Formula:C50H69N15O9Peso molecolare:1,024.2 g/molP61 (343-355), M. leprae
<p>Catalogue peptide; min. 95% purity</p>Formula:C62H107N21O24Peso molecolare:1,530.67 g/molC-Reactive Protein (CRP) (77-82)
<p>Catalogue peptide; min. 95% purity</p>Formula:C23H40N6O10Peso molecolare:560.61 g/mol[Cys(Acm)20,31]-EGF (20-31)
<p>Catalogue peptide; min. 95% purity</p>Formula:C63H98N16O23S3Peso molecolare:1,543.77 g/mol[D-Ser13]-Somatostatin-14
<p>Catalogue peptide; min. 95% purity</p>Formula:C76H104N18O19S2Peso molecolare:1,637.91 g/molCripto-1, CR-1
<p>Catalogue peptide; min. 95% purity</p>Formula:C86H129N27O27S2Peso molecolare:2,037.26 g/molRenoguanylin (eel)
<p>Catalogue peptide; min. 95% purity</p>Formula:C66H102N16O22S4Peso molecolare:1,599.90 g/molIDR-1 trifluoroacetate salt
CAS:<p>IDR-1 is a peptide that is derived from the sequence of the human typhimurium protein. IDR-1 has been shown to have anti-inflammatory properties and modulates immune responses in mice. In particular, IDR-1 inhibits neutrophil chemotaxis by inhibiting formyl peptide receptor signaling. This peptide also inhibits bacterial chemokines, which are important for the recruitment of neutrophils. IDR-1 also has been shown to be effective against methicillin-resistant Staphylococcus aureus (MRSA) and pertussis.</p>Formula:C65H118N18O15Purezza:Min. 95%Peso molecolare:1,391.74 g/mol[Sar1]-Angiotensin I/II (1-7) amide
<p>Catalogue peptide; min. 95% purity</p>Formula:C40H63N13O8Peso molecolare:854.02 g/molPancreatic Polypeptide (31-36) (free acid) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C36H60N12O9Peso molecolare:805 g/molLeucokinin VII
<p>Catalogue peptide; min. 95% purity</p>Formula:C40H52N10O12Peso molecolare:864.9 g/mol[Tyr11]-Somatostatin-14
<p>Catalogue peptide; min. 95% purity</p>Formula:C76H104N18O20S2Peso molecolare:1,653.91 g/molSU086
CAS:<p>Chalcone compound that decreases HSP90 levels and inhibits prostate cancer cell growth and migration in vitro</p>Formula:C18H17NO6Peso molecolare:343.33 g/molScrambled TRAP Fragment
<p>Catalogue peptide; min. 95% purity</p>Formula:C34H57N11O8Peso molecolare:747.90 g/mol[D-Ala2,Leu5,Arg6] Enkephalin
<p>Catalogue peptide; min. 95% purity</p>Formula:C35H51N9O8Peso molecolare:725.85 g/molNeuron Specific Peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C161H262N52O51S4Peso molecolare:3,870.44 g/molLytic Peptide, SB - 37
<p>Catalogue peptide; min. 95% purity</p>Formula:C188H320N54O45SPeso molecolare:4,088.94 g/mol[Nle13]-Motillin
<p>Catalogue peptide; min. 95% purity</p>Formula:C121H190N34O35Peso molecolare:2,681 g/molbeta-Amyloid (16-20)
<p>Catalogue peptide; min. 95% purity</p>Formula:C35H52N6O6Peso molecolare:652.84 g/molMyristoylated ADP-Ribosylation Factor 1, myr-ARF1 (2-17)
<p>Catalogue peptide; min. 95% purity</p>Formula:C99H157N21O22Peso molecolare:1,993.49 g/mol[Met5, Lys6, Arg7] a-Neo-Endorphin (1-7)
<p>Catalogue peptide; min. 95% purity</p>Formula:C39H59N11O9SPeso molecolare:858.04 g/mol[Pro18, Asp21] beta-Amyloid (17-21), iAb5
<p>Catalogue peptide; min. 95% purity</p>Formula:C33H43N5O8Peso molecolare:637.74 g/mol2A/2B Dengue Protease Substrate
<p>Catalogue peptide; min. 95% purity</p>Formula:C39H68N16O11Peso molecolare:937.08 g/molAcetalin 3, Opioid Receptor Antagonist 3
<p>Catalogue peptide; min. 95% purity</p>Formula:C42H61N114O8S2Peso molecolare:912.15 g/molAF-16 trifluoroacetate salt
CAS:AF-16 trifluoroacetate salt is a synthetic peptide, which is derived from chemical synthesis with tailored modifications to enhance its stability and efficacy. This compound acts by specifically binding to target receptors or proteins, facilitating the study of biochemical pathways and mechanisms at the molecular level. It is particularly used in biological and biochemical research settings to probe cellular processes, offering insights into protein interactions and signaling pathways.Formula:C71H119N25O25SPurezza:Min. 95%Peso molecolare:1,754.92 g/molP75-TNFR Fragment
<p>Catalogue peptide; min. 95% purity</p>Formula:C53H85N15O15SPeso molecolare:1,204.42 g/mol[D-Pro2,D-Phe7,D-Trp9]-Substance P
<p>Catalogue peptide; min. 95% purity</p>Formula:C72H105N19O13SPeso molecolare:1,476.82 g/molHJ Inhibitor Peptide 2
<p>Catalogue peptide; min. 95% purity</p>Formula:C48H61N13O7SPeso molecolare:964.16 g/molFibrinogen Binding Inhibitory Peptide
<p>Catalogue peptide; min. 95% purity</p>Formula:C50H80N18O16Peso molecolare:1,189.29 g/molbeta I probe
<p>Catalogue peptide; min. 95% purity</p>Formula:C81H116N26O24Peso molecolare:1,873.99 g/molch-Relaxing Peptide (CARP)
<p>Catalogue peptide; min. 95% purity</p>Formula:C36H67N11O7S2Peso molecolare:830.13 g/molLocustachykinin II
<p>Catalogue peptide; min. 95% purity</p>Formula:C50H76N14O12Peso molecolare:1,065.4 g/molStaphylococcal Alpha-Toxin P 1
<p>Catalogue peptide; min. 95% purity</p>Formula:C61H98N16O24Peso molecolare:1,439.55 g/mol[Glu10]-ACTH (1-17)
<p>Catalogue peptide; min. 95% purity</p>Formula:C98H149N29O25SPeso molecolare:2,165.50 g/molBiotin-(Cys1,Lys(biotinyl)18)-Calcitonin (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C171H254N4O16Peso molecolare:3,870.52 g/molP62 (417-429), M. leprae
<p>Catalogue peptide; min. 95% purity</p>Formula:C65H116N16O17Peso molecolare:1,393.75 g/mol[Met5, Lys6] a-Neo-Endorphin (1-6)
<p>Catalogue peptide; min. 95% purity</p>Formula:C33H47N7O8SPeso molecolare:701.85 g/molStresscopin-Related Peptide (free acid) (human)
<p>Catalogue peptide; min. 95% purity</p>Formula:C205H357N67O58Peso molecolare:4,688.54 g/molSB-423562
CAS:<p>SB-423562 is a synthetic compound, which is developed as a small molecule inhibitor, produced through chemical synthesis in a laboratory setting. Its mode of action involves selectively interfering with a specific biological pathway by binding to its target protein, thereby inhibiting its activity. This targeted action allows for precise modulation of signaling pathways, which can be pivotal in therapeutic interventions.</p>Formula:C26H32N2O4Purezza:Min. 95%Colore e forma:PowderPeso molecolare:436.54 g/molDynorphin A (6-17), porcine
<p>Catalogue peptide; min. 95% purity</p>Formula:C71H120N26O17Peso molecolare:1,609.91 g/molrec GM-CSF (human)
CAS:<p>Please enquire for more information about rec GM-CSF (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purezza:Min. 95%[Des-Gln16]-PACAP (6-27), amide, human, ovine, rat
<p>Catalogue peptide; min. 95% purity</p>Formula:C116H185N31O29SPeso molecolare:2,510 g/molEC 23
CAS:<p>EC 23 is a synthetic retinoid that belongs to the class of chemical compounds called retinoids. Retinoids are natural or synthetic substances that have a high affinity for binding to receptors on the cell surface and activating them. EC 23 has been shown to induce bacterial enzymes that break down long-chain fatty acids, which are toxic to bacteria. It also has been shown to be potent inducers of cellular differentiation in certain animal models, including the mouse embryo eye. EC 23 binds with high affinity to bacterial enzyme and inhibits its activity. It also has been shown to inhibit the growth of certain types of cancer cells in culture, but not others.</p>Formula:C23H24O2Purezza:Min. 95%Peso molecolare:332.44 g/molPannexin-1 Fragment (4512)
<p>Catalogue peptide; min. 95% purity</p>Formula:C55H94N18O24Peso molecolare:1,391.47 g/molEndotrophin (mouse) trifluoroacetate salt
CAS:<p>A carboxyl-terminal cleavage product of collagen 6 alpha-3 chain which is produced and released by adipocytes and massively upregulated in malignant tumors of breast, liver colon and pancreas. Endotrophin provides a link between obesity and aggressive tumor growth and may serve as sensitive diagnostic marker and valid therapeutic target for designing better strategies to treat cancer and ameliorate obesity-induced insulin resistance.</p>Formula:C345H520N92O106S7Purezza:Min. 95%Peso molecolare:7,876.84 g/molAcetyl-(D-Arg2)-GRF (1-29) amide (human) trifluoroacetate salt
CAS:<p>Please enquire for more information about Acetyl-(D-Arg2)-GRF (1-29) amide (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C154H255N47O43SPurezza:Min. 95%Peso molecolare:3,485.03 g/molAlprostadil alfadex
CAS:<p>Alprostadil alfadex is a medicinal drug that has been found to have anticancer properties. It works by inhibiting the growth of cancer cells and inducing apoptosis, or programmed cell death. This drug is an analog of a naturally occurring protein that acts as a tumor inhibitor in humans. Alprostadil alfadex has been shown to be effective against various types of cancer, including those found in the urinary tract and prostate. It works by blocking the action of certain enzymes and proteins involved in the cell cycle, thereby preventing cancer cells from dividing and multiplying. Chinese researchers have also found that this drug has a kinase-inhibiting effect, which may contribute to its anticancer activity.</p>Formula:C36H60O30•C20H34O5Purezza:Min. 95%Colore e forma:PowderPeso molecolare:1,327.3 g/molIR-806
CAS:<p>Please enquire for more information about IR-806 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C37H45ClN2O6S2•NaPurezza:Min. 95%Peso molecolare:736.34 g/molPI3K-gamma inhibitor 1
CAS:<p>PI3K-gamma inhibitor 1 is a small molecule inhibitor, which is selectively synthesized for targeting the PI3K-gamma isoform. This inhibitor is derived through precise medicinal chemistry, involving the synthesis of compounds that specifically interact with the catalytic domain of the phosphoinositide 3-kinase gamma (PI3K-γ) enzyme. Its mode of action involves the selective inhibition of the PI3K-γ pathway, a critical signaling route responsible for modulating immune cell functions and inflammatory responses.</p>Formula:C32H26N8O2SPurezza:Min. 95%Peso molecolare:586.67 g/molH-Gln-pNA
CAS:<p>Please enquire for more information about H-Gln-pNA including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C11H14N4O4Purezza:Min. 95%Peso molecolare:266.25 g/mol(Pyr³)-Amyloid B-protein (3-42) trifluoroacetate
CAS:<p>Please enquire for more information about (Pyr³)-Amyloid B-protein (3-42) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C196H299N53O55S•(C2HF3O2)xPurezza:Min. 95 Area-%N-Acetylpiperazine-N-(4-phenol) ketoconazole
CAS:<p>N-Acetylpiperazine-N-(4-phenol) ketoconazole is an analog inhibitor that has been shown to inhibit the activity of several kinases. This compound has been tested against a variety of cancer cells and has demonstrated potent anticancer activity, inducing apoptosis in Chinese hamster ovary cells. N-Acetylpiperazine-N-(4-phenol) ketoconazole also inhibits the activity of dapoxetine, a drug used to treat premature ejaculation. In addition to its anticancer properties, this compound has shown promise as an anti-inflammatory agent due to its ability to inhibit the production of prostaglandins. This inhibitor can be detected in urine and may have potential therapeutic applications in the treatment of various cancers.</p>Formula:C38H42Cl2N6O6Purezza:Min. 95%Colore e forma:PowderPeso molecolare:749.7 g/molSteroid Free Serum
<p>Steroid Free Serum is a high-quality serum that is free from steroids. It is commonly used in various Life Sciences applications, including research and diagnostic assays. This serum contains important components such as alpha-fetoprotein, angiotensin-converting enzyme, collagen, erythropoietin, pegylated growth factor, chemokines, and antibodies with neutralizing properties.</p>Purezza:Min. 95%Isodesmosine
CAS:<p>Isodesmosine is an amino acid and naturally occurring cross-linking compound, which is primarily found in elastin, a key protein in connective tissues. Its source is the structural protein elastin, where it forms stable cross-links that contribute to the elasticity and resilience of various tissues, notably the skin, lungs, and blood vessels. The mode of action of isodesmosine involves its integration into the elastin matrix, providing durability and elasticity through covalent bonding within and between polypeptide chains.</p>Formula:C24H40N5O8Purezza:Min. 95%Peso molecolare:526.6 g/molLY 117018
CAS:<p>LY 117018 is a dopamine analog that binds to the toll-like receptor and blocks the production of proinflammatory cytokines. LY 117018 also inhibits epidermal growth factor (EGF) in liver cells and cyclin D2, which is involved in cell cycle regulation. This drug has been shown to be effective in a model system using fetal bovine serum with angiogenic factors, such as vascular endothelial growth factor (VEGF). The effect on blood vessels was dose-dependent for LY 117018. This drug potentiates the actions of 17β-estradiol on mcf-7 cells and serum prolactin levels are significantly decreased in vivo by this compound.</p>Formula:C27H25NO4SPurezza:Min. 95%Peso molecolare:459.6 g/molOligopeptide-51
<p>Please enquire for more information about Oligopeptide-51 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purezza:Min. 95%H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt
CAS:<p>H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt is an anticoagulant drug that prevents the formation of blood clots by inhibiting the enzyme thrombin. This drug is effective in enhancing blood flow and oxygen supply to the heart and other organs. H-Glu-Gly-Arg-chloromethylketone trifluoroacetate salt has been shown to have a positive effect on patients with congestive heart failure. It has also been used as an adjuvant therapy in bypassing procedures, where clotting occurs at the site of an artificial conduit placed in the body to allow blood flow between two points. In vitro studies have demonstrated that this drug inhibits protease activity, which may be due to its ability to inhibit fibrinogen and serine protease activity.</p>Formula:C14H25ClN6O5Purezza:Min. 95%Peso molecolare:392.84 g/molBodipy cyclopamine
CAS:<p>Fluorescent derivative of cyclopamine</p>Formula:C49H70BF2N5O4Purezza:Min. 95%Colore e forma:Red SolidPeso molecolare:841.92 g/mol1-(Carboxymethyl)-1H-benzo[G]indole-2-carboxylic acid
CAS:<p>Please enquire for more information about 1-(Carboxymethyl)-1H-benzo[G]indole-2-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H11NO4Purezza:Min. 95%Peso molecolare:269.25 g/molFAPI-46 trifluoroacetate
CAS:<p>FAPI-46 trifluoroacetate is a fibroblast activation protein (FAP) inhibitor, which is synthesized as part of targeted cancer research efforts. It is derived from chemical engineering processes focusing on the modification of small molecules to selectively interact with FAP, an enzyme overexpressed in cancer-associated fibroblasts (CAFs) within the tumor microenvironment. FAPI-46 binds to and inhibits FAP, reducing its enzymatic activity. By blocking FAP, FAPI-46 trifluoroacetate disrupts the tumor-promoting interactions between CAFs and tumor cells, potentially impeding tumor growth and progression.</p>Formula:C41H57F2N11O9•(C2HF3O2)xPurezza:Min. 95%ROPA
CAS:<p>ROPA or resiniferonol 9,13,14-orthophenylacetate is an analogue of resiniferatoxin that has been shown to have synergistic interactions with detergents, such as Tween-80, in the removal of wheat germ agglutinin (WGA) from Brucella. ROPA is also active against herpes simplex virus and tumour necrosis factor-alpha (TNF-α). When combined with a basic protein, it can activate the receptor and inhibits the formation of dry weight. ROPA has been shown to be able to inhibit the growth of infectious bacteria, such as those that cause tuberculosis or brucellosis. The mechanism for this inhibition is not clear, but may be due to its ability to bind to water molecules and inhibit their binding with bacterial cytoplasmic membranes.</p>Formula:C28H32O6Purezza:Min. 95%Peso molecolare:464.55 g/mol18:0 PE-DTPA
CAS:<p>18:0 PE-DTPA is a cationic amphiphile that is composed of 18:0 phosphatidylethanolamine (PE) and DTPA. It has a strong affinity for gadolinium, which is used in MRI imaging. 18:0 PE-DTPA micelles are used to deliver gadolinium to the target site where it accumulates inside cells. The accumulation of gadolinium in cells can be detected by MRI.</p>Formula:C55H103N4O17PPurezza:Min. 95%Peso molecolare:1,123.4 g/mol(+)-Guaiacin
CAS:<p>Guaiacin is a guaianolide that is an inhibitor of the protein phosphatase 1 (PP1). It has been shown to bind to PP1 and inhibit its activity, leading to increased levels of the cellular messenger cAMP. Guaiacin has also been shown to activate PP2A, which may contribute to its anti-inflammatory effects. Guaiacin has been used as a research tool in cell biology and pharmacology studies. It is available in high purity and can be used as an antibody reagent for immunocytochemistry.</p>Formula:C20H24O4Purezza:Min. 95%Peso molecolare:328.4 g/molGC-globulin from human plasma
CAS:<p>GC-globulin is a protein that is found in human plasma. It can be used as an activator, inhibitor, or ligand for ion channels, receptors, and other proteins. GC-globulin has been shown to inhibit the function of receptor tyrosine kinases on B-cells with antibodies that bind to the Fc region of the protein. This inhibition prevents activation of the B-cell receptor and thus inhibits antibody production by B cells. GC-globulin also binds to peptides during cell division and functions as a cofactor for proteolytic enzymes such as plasminogen activator (PA). GC-globulin has been shown to activate PA which leads to fibrinolysis.</p>Purezza:Min. 95%Nalmefene
CAS:Prodotto controllato<p>μ- and κ- opioid receptor antagonist; partial agonist of δ- opioid receptors</p>Formula:C21H25NO3Purezza:Min. 95%Peso molecolare:339.43 g/mol3'-Hydroxybupivacaine
CAS:<p>3'-Hydroxybupivacaine is an analog of the local anesthetic bupivacaine that has shown potential as an anticancer agent. It acts as a kinase inhibitor, which can prevent the growth and spread of cancer cells. 3'-Hydroxybupivacaine has been found in human urine samples and has been shown to induce apoptosis in tumor cells. This drug is also effective against a variety of Chinese hamster ovary (CHO) cell lines, indicating its broad-spectrum activity against cancer cells. Additionally, 3'-Hydroxybupivacaine has been shown to enhance the anti-tumor effects of other protein kinase inhibitors, such as oseltamivir. Overall, this drug shows promise as a potential therapeutic option for cancer treatment.</p>Formula:C18H28N2O2Purezza:Min. 95%Peso molecolare:304.4 g/molCagrilintide
CAS:<p>Please enquire for more information about Cagrilintide including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Vancomycin methyl ester
CAS:<p>Vancomycin methyl ester is an analog of the antibiotic vancomycin that has been shown to have anticancer properties. It induces apoptosis in cancer cells, particularly in Chinese hamster ovary (CHO) cells and human tumor cell lines. Vancomycin methyl ester acts as a cyclin-dependent kinase inhibitor by binding to the ATP-binding site of these kinases, thereby inhibiting their activity. This protein kinase inhibition leads to the downregulation of proteins involved in cell cycle progression, such as cyclin D1 and E2F1, ultimately leading to cell death. Vancomycin methyl ester has also been found to inhibit the growth of certain types of cancer cells by blocking angiogenesis, which is the formation of new blood vessels that tumors need for their growth and survival. Additionally, this compound has been detected in human urine after administration and may have potential therapeutic applications in cancer treatment.</p>Formula:C67H77Cl2N9O24Purezza:Min. 95%Peso molecolare:1,463.3 g/molUM729
CAS:<p>UM729 is an advanced surface coating, which is a chemical formulation with the aim of enhancing surface durability and protection. Sourced from novel polymeric materials, UM729 is designed to form a robust and resilient layer when applied to various substrates. Its mode of action involves cross-linking at the molecular level, creating a cohesive barrier that offers resistance to environmental factors such as abrasion, moisture, and UV radiation.</p>Formula:C20H25N5O2Purezza:Min. 95%Peso molecolare:367.44 g/molCrotonyl coenzyme A
CAS:<p>Involved in the metabolism of fatty acids and amino acids</p>Formula:C25H40N7O17P3SPurezza:Min. 95%Peso molecolare:835.6 g/molH-ASCLYGQLPK-OH
<p>Peptide H-ASCLYGQLPK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Formula:C48H76N12O13SPeso molecolare:1,079.27 g/molOpiorphin trifluoroacetate
CAS:Please enquire for more information about Opiorphin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C29H48N12O8•(C2HF3O2)xPurezza:Min. 95%Cerebellin trifluoroacetate
CAS:<p>Please enquire for more information about Cerebellin trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C69H113N23O23•(C2HF3O2)4Purezza:Min. 95%Peso molecolare:2,088.86 g/molL-a-Phosphatidylcholine - PC 20
CAS:<p>L-a-Phosphatidylcholine (PC) is a phospholipid that is present in all living cells. It is the major component of biological membranes and is essential for maintaining cell membrane integrity. PC 20 is a purified form of L-a-Phosphatidylcholine, made from soybean extract. The purity of PC 20 has been shown by its ability to inhibit nitrite ion production from soybean extract in vitro. PC 20 also has low bioavailability, meaning that it may not be absorbed well into the bloodstream following oral consumption. This may be due to the uptake of PC 20 by other organs and tissues in the body, such as the liver or spleen, before it can be transported to the blood stream. Further research is needed to determine how PC 20 affects colorectal adenocarcinoma cells.</p>Formula:C42H80NO8PPurezza:Min. 95%Peso molecolare:758.06 g/mol3-Bromo-L-thyroxine
CAS:Please enquire for more information about 3-Bromo-L-thyroxine including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C15H11BrI3NO4Purezza:Min. 95%Peso molecolare:729.87 g/mol3-Amino-6,7,8,9-tetrahydro-5H-1-thia-10-aza-cyclohepta[f]indene-2-carboxylic acid (5-phenyl-[1,3,4]thiadiazol-2-yl)-amide
CAS:This peptide is a research tool that has been shown to activate the ATP-sensitive potassium ion channel, which is found in the membranes of many cells. This peptide also binds to the beta2-adrenergic receptor and has been shown to inhibit the activity of protein kinase C. The CAS number for this peptide is 400863-77-6.Formula:C21H19N5OS2Purezza:Min. 95%Peso molecolare:421.5 g/molCA 125 antibody (biotin)
<p>CA 125 antibody (biotin) was raised in mouse using affinity pure human CA 125 antigen as the immunogen.</p>Solvent Green 3
CAS:<p>Solvent Green 3 is a sulfa drug with bactericidal activity. It binds to the bacterial cell wall and prevents the production of folic acid, which is vital for bacterial growth. The binding of Solvent Green 3 to the cell wall increases thermal expansion, causing lysis of the bacteria. Solvent Green 3 has been used in sample preparation for analytical methods that require high sensitivity and accuracy. It has also been used to measure hydrochloric acid in food samples, as well as boron nitride in paint products. This drug also has acute toxicities and can be used as an analytical chemistry reagent for determining p-hydroxybenzoic acid and acyl chain content in various materials such as cell culture media or human plasma.</p>Formula:C28H22N2O2Purezza:Min. 95%Colore e forma:White PowderPeso molecolare:418.49 g/molH-GILGFVFTL-OH
CAS:<p>FluM1 (58-66) is a short part of the matrix protein of Influenza A virus which is the most abundant component of this enveloped virus localized under the viral lipid envelope. The GILGFVFTL epitope is highly conserved in Influenza A virus strains at a rate of 93% for 69 strains tested. Human Influenza epitopes may bind MHC molecules and then may be recognized by CD8+ cytotoxic T cells. Applications of FluM1 (58-66): FluM1 (58-66) is used to stimulate CTL responses in peripheral blood mononuclear cells (PBMCs). Then, ELISPOT assay is used to quantify peptide epitope specificity and IFN-γ releasing effector cells. FluM1 (58-66) has shown CTL responses qualified of immunodominant with restriction by HLA-A*02:01. It has also been detected CTL responses when FluM1 (58-66) is restricted by all HLA-C. Therefore, FluM1 (58-66) may help to understand the reaction of immune system against Influenza virus of each populations having different HLA type. FluM1 (58-66) has indeed prompted research to develop T-cell vaccine strategies capable of inducing specific CTL responses in patients upon immunization with Influenza M1 antigenic epitope. MVA-NP+M1 vaccine use GILGFVFTL epitope and is tested in clinical trial. Potential cross-reactivity with HIV-1 p17 Gag (77-85): Moreover, FluM1 (58-66) share similarities with HIV-1 p17 Gag (77-85) which can potentially show a cross-reactivity between these epitopes. It has been demonstrated a cross-reactivity and results suggest that immunity following infection by Influenza virus causes specific immune response to HIV-1 p17 Gag (77-85).</p>Formula:C49H75N9O11Peso molecolare:966.18 g/molAngiotensin A (1-7) trifluoroacetate
CAS:<p>Endogenous heptapetide which causes vasodilation and has anti-hypertensive properties.</p>Formula:C40H62N12O9•(C2HF3O2)xPurezza:Min. 95%Colore e forma:PowderPeso molecolare:855 g/molPF2562
CAS:<p>PF2562 is a potent and selective activator of the metabotropic glutamate receptor mGluR5. It is a competitive antagonist at AMPA receptors, with no activity at NMDA or kainate receptors. PF2562 is known to inhibit protein interactions between the proteins encoded by the gene for the metabotropic glutamate receptor mGluR5 and its ligands, such as l-glutamic acid and d-serine. This inhibition leads to activation of these receptors, which may be important in research on neurological disorders and other diseases involving glutamate signaling.</p>Formula:C19H17N5OPurezza:Min. 95%Peso molecolare:331.4 g/molAptiganel
CAS:<p>Aptiganel (CAS No. 137159-92-3) is a research tool that can be used to study the interaction of proteins and peptides with ion channels. It is an inhibitor of ion channels that blocks the flow of ions through them, thereby preventing the generation of action potentials. Aptiganel is a potent inhibitor of voltage-dependent calcium channels, which are found in neurons and muscle cells. This drug binds to ligands on the extracellular side of ion channel receptors and prevents ligand binding to the receptor, blocking ion flow. Aptiganel has been shown to inhibit voltage-gated potassium channels in rat dorsal root ganglion cells, human neuroblastoma cells grown in culture, and cultured mouse embryo spinal cord neurons. Aptiganel also inhibits voltage-gated sodium channels in rat dorsal root ganglion cells and cultured mouse embryo spinal cord neurons.</p>Formula:C20H21N3Purezza:Min. 95%Peso molecolare:303.4 g/molSiratiazem
CAS:<p>Siratiazem is a calcium-channel blocker that is used for the treatment of cardiac arrhythmia and hypertension, as well as for the prevention of congestive heart failure. Siratiazem is a prodrug that is converted to its active form by hydrolysis in the liver. It binds to the L-type calcium channels in cardiac muscle cells, thereby blocking calcium influx and decreasing the excitability of these cells. This drug has been shown to be effective in phase 1 clinical trials, with no major adverse effects. Siratiazem can cause symptoms such as nausea, vomiting, diarrhea, or constipation and may also have effects on insulin resistance and ventricular dysfunction.</p>Formula:C24H30N2O4SPurezza:Min. 95%Peso molecolare:442.57 g/molTES
CAS:<p>TES, also known as N-Tris(hydroxymethyl)methyl-2-aminoethanesulfonic acid, is a buffering agent that is used in protein assays and forms complexes with DNA and copper ions. The optimal pH range of this zwitterionic buffer is 6.8-8.2 and its pKa is 7.4.</p>Formula:C6H15NO6SPurezza:Min. 95%Colore e forma:PowderPeso molecolare:229.25 g/mol3-Indolepropionyl-coa
CAS:<p>3-Indolepropionyl-coa is a potent inhibitor of cancer cell cycle and has been found to induce apoptosis in human cancer cells. This compound is an analog of the naturally occurring urinary metabolite, indole-3-acetic acid, which has been shown to have anticancer properties. 3-Indolepropionyl-coa is a promising medicinal compound for the development of novel anticancer drugs due to its ability to inhibit protein kinase activity in Chinese hamster ovary cells. It has also been reported to inhibit tumor growth and proliferation by blocking the production of cyclin-dependent kinases, which are essential for cell division. The potential use of 3-Indolepropionyl-coa as a therapeutic agent for cancer treatment warrants further investigation.</p>Formula:C32H45N8O17P3SPurezza:Min. 95%Peso molecolare:938.7 g/molβ-Chlornaltrexamine dihydrochloride
CAS:Prodotto controllato<p>β-Chlornaltrexamine dihydrochloride (β-CNTA) is a non-competitive antagonist of the kappa opioid receptor. It has been shown to inhibit camp levels and whole-cell recordings in cells expressing the G protein, guanine nucleotide binding proteins, and ryanodine receptor. β-CNTA also inhibits locomotor activity in mice and reverses the effects of morphine on rotarod performance. In addition, β-CNTA has been shown to be effective against human cell line HL60.END></p>Formula:C24H32Cl2N2O3•2HClPurezza:Min. 95%Peso molecolare:540.35 g/molH-Val-Val-Val-OH trifluroacetate
CAS:<p>Please enquire for more information about H-Val-Val-Val-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C15H29N3O4•(C2HF3O2)xPurezza:Min. 95%H-Leu-Leu-Gly-OH trifluroacetate
CAS:<p>Please enquire for more information about H-Leu-Leu-Gly-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H27N3O4•C2HF3O2Purezza:Min. 95%Peso molecolare:415.4 g/molEthyl N,N,N',N'-Tetraisopropylphosphorodiamidite
CAS:<p>Please enquire for more information about Ethyl N,N,N',N'-Tetraisopropylphosphorodiamidite including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H33N2OPPeso molecolare:276.4 g/molRetroprogesterone
CAS:Prodotto controllatoRetroprogesterone is a human urine-derived compound that has shown promising results in the field of cancer research. It is an analog of oseltamivir and acts as a kinase inhibitor, which makes it an effective anticancer agent. Retroprogesterone has been shown to induce apoptosis in cancer cells by inhibiting protein kinases that are essential for cell survival and proliferation. This compound has demonstrated potent tumor growth inhibition in Chinese hamster ovary cells, making it a potential candidate for cancer therapy. Retroprogesterone has also been studied as an inhibitor of various kinases involved in cancer development and progression. Its ability to target multiple pathways involved in cancer makes it a valuable tool for future research and drug development.Formula:C21H30O2Purezza:Min. 95%Colore e forma:PowderPeso molecolare:314.5 g/molhCG protein
<p>The hCG protein is a growth factor that plays a crucial role in various biological processes. It is involved in the regulation of cell growth, differentiation, and development. This protein has been extensively studied in the field of Life Sciences and has shown promising results in various applications. One of the key characteristics of the hCG protein is its ability to interact with arginase, an enzyme involved in the metabolism of arginine. Through molecular docking studies, it has been shown that hCG can bind to arginase and modulate its activity, leading to potential therapeutic applications. Monoclonal antibodies targeting the hCG protein have been developed for research purposes. These antibodies are highly specific and can be used in immunoassays to detect and quantify hCG levels in human serum samples. They have also been used for the immobilization of hCG on electrodes, enabling the development of biosensors for diagnostic purposes. Furthermore, studies have demonstrated that the hCG protein plays a role in the regulation of mes</p>Purezza:Min. 95%H-Ala-Ala-Ala-OH trifluroacetate
CAS:<p>Please enquire for more information about H-Ala-Ala-Ala-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C9H17N3O4•(C2HF3O2)xPurezza:Min. 95%Thymopentin acetate salt
CAS:Prodotto controllato<p>Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt is an experimental model system that has been shown to replicate the physiological effects of thymopoietin in vitro. It has also been shown to inhibit the growth of Candida glabrata, a fungus that causes infection in patients with HIV or AIDS. Thymopentin acetate salt H-Arg-Lys-Asp-Val-Tyr-OH acetate salt has been shown to activate both toll like receptor and IL2 receptor, which may be due to its ability to stimulate polyamine synthesis.</p>Formula:C30H49N9O9Purezza:Min. 95%Peso molecolare:679.77 g/molMethotrexate antibody
<p>The Methotrexate antibody is a monoclonal antibody that specifically targets and binds to Methotrexate, a commonly used cytotoxic drug in the field of Life Sciences. This antibody has been extensively tested and validated for its high affinity and specificity towards Methotrexate. It can be used in various applications such as ELISA, Western blotting, immunohistochemistry, and flow cytometry. The Methotrexate antibody works by binding to Methotrexate molecules and preventing their interaction with their target enzymes involved in DNA synthesis. This inhibits the growth of cancer cells and autoimmune responses mediated by activated T-cells. Additionally, this antibody can also be utilized as a tool for studying the intracellular localization and trafficking of Methotrexate within cells. The unique features of this Methotrexate antibody include its ability to recognize both free Methotrexate molecules as well as Methotrexate conjugated to proteins or other biomolecules. It exhibits minimal cross-reactivity with</p>Taurolithocholic acid-d4 sodium
CAS:Please enquire for more information about Taurolithocholic acid-d4 sodium including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C26H44NNaO5SPurezza:Min. 95%Peso molecolare:509.7 g/molMucin antibody
Mucin antibody was raised in mouse using Mucin isolated from ovarian mucinous cysts and colonic mucosa as the immunogen.UK 383367
CAS:<p>UK 383367 is a chemical compound classified as a synthetic small molecule, which is derived from a meticulously controlled chemical synthesis process. Its mode of action involves modulating specific biochemical pathways by binding to target receptors, thereby influencing cellular processes at a molecular level. This compound is utilized extensively in pharmaceutical research for its potential therapeutic effects, particularly in the context of investigating receptor activity and signaling pathways. Additionally, UK 383367 finds applications in various industrial processes, serving as an intermediate in the synthesis of more complex compounds. Due to its precision in targeting and influencing biological systems, UK 383367 is a valuable tool for scientists seeking to elucidate the mechanistic pathways underlying disease and for the development of novel therapeutic strategies.</p>Formula:C15H24N4O4Purezza:Min. 95%Peso molecolare:324.38 g/mol8-(3-Chlorostyryl)caffeine
CAS:Prodotto controllato<p>8-(3-Chlorostyryl)caffeine is a caffeine derivative that binds to the adenosine A3 receptor. It has been shown to inhibit locomotor activity and increase diastolic pressure in knockout mice lacking the adenosine A3 receptor. 8-(3-Chlorostyryl)caffeine has also been shown to have inhibitory properties on cyclase, which is necessary for the production of cAMP, the second messenger in cells. This drug also inhibits dopamine release from neurons and hydrogen bond formation with DNA, protein, and other biomolecules. Lastly, 8-(3-Chlorostyryl)caffeine can bind to both A1 and A2A receptors as well as to dna binding sites.</p>Formula:C16H15ClN4O2Purezza:Min. 95%Colore e forma:PowderPeso molecolare:330.77 g/molImidazole-15N2
CAS:Imidazole-15N2 is an analog of the calcium channel blocker nifedipine that has been shown to have anticancer properties. It induces apoptosis in cancer cells by inhibiting protein kinases, which are involved in tumor growth and survival. Imidazole-15N2 has been studied in both Chinese hamster ovary cells and human cancer cell lines, where it has demonstrated potent inhibition of kinase activity. This drug is a promising candidate for the development of novel cancer therapies due to its ability to selectively target cancer cells while sparing normal cells. Imidazole-15N2 can be detected in urine and may serve as a biomarker for the presence of protein kinase inhibitors in the body.Formula:C3H4N2Purezza:Min. 95%Peso molecolare:70.06 g/molH-Gly-Leu-Gly-OH trifluroacetate
CAS:Please enquire for more information about H-Gly-Leu-Gly-OH trifluroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C10H19N3O4•C2HF3O2Purezza:Min. 95%Peso molecolare:359.3 g/molLHRH (1-5) (free acid) trifluoroacetate salt
CAS:<p>LHRH (1-5) (free acid) trifluoroacetate salt is a synthetic hormone that is used in the treatment of prostate cancer. It inhibits the release of luteinizing hormone and follicle-stimulating hormone from the anterior pituitary gland, which suppresses testosterone production by the testes. LHRH (1-5) (free acid) trifluoroacetate salt is synthesized industrially using a liquid phase synthesis. The product may be recycled by returning it to the manufacturing process or using it as an additive for plastics or other industrial products. LHRH (1-5) (free acid) trifluoroacetate salt was shown to be active against tumor cells in culture and inhibited cell growth in culture. This drug has been shown to inhibit the production of nitric oxide, which may contribute to its anti-tumor activity. LHRH (1-5) (free acid)</p>Formula:C34H38N8O9Purezza:Min. 95%Colore e forma:PowderPeso molecolare:702.71 g/molBenzoic acid 5-amino-1-(4-methoxy-benzenesulfonyl)-1H-pyrazol-3-yl ester
CAS:<p>Benzoic acid 5-amino-1-(4-methoxy-benzenesulfonyl)-1H-pyrazol-3-yl ester is a synthetic chemical compound used primarily in advanced organic synthesis. It is derived from benzoic acid and functionalized with a pyrazole moiety, enhancing its reactivity and versatility in chemical transformations. This compound acts as an intermediate in the synthesis of more complex molecules, playing a crucial role as a precursor or reagent due to its unique structure, which facilitates targeted chemical modifications.</p>Formula:C17H15N3O5SPurezza:Min. 95%Peso molecolare:373.4 g/molEthyl N,N-bis(1-methylethyl)phosphoramidochloridite
CAS:<p>Please enquire for more information about Ethyl N,N-bis(1-methylethyl)phosphoramidochloridite including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C8H19ClNOPPeso molecolare:211.67 g/mol1-Palmitoyl-rac-glycero-3-phosphocholine
CAS:<p>1-Palmitoyl-rac-glycero-3-phosphocholine is a biological lipid that has been shown to be a potent growth factor for cells in culture. It binds to DNA and modulates transcriptional regulation. 1-Palmitoyl-rac-glycero-3-phosphocholine also inhibits the production of lysophosphatidylcholine, which is an inflammatory mediator that promotes the release of histamine from mast cells. This compound may be useful as an antimicrobial agent, as it has been shown to inhibit the growth of bacteria and fungi.</p>Formula:C24H50NO7PPurezza:Min. 95%Peso molecolare:495.63 g/molKotalanol
CAS:<p>Alpha-glucosidase inhibitor; anti-diabetic</p>Formula:C12H24O12S2Purezza:Min. 95%Peso molecolare:424.44 g/molSermorelin acetate
CAS:Prodotto controllato<p>Sermorelin acetate is a synthetic peptide, which is an analogue of the naturally occurring growth hormone-releasing hormone (GHRH). It is derived from recombinant DNA technology, representing the first 29 amino acids (1-29) of endogenous GHRH. Its mode of action involves binding to and activating the GHRH receptor on the anterior pituitary gland, which subsequently stimulates the release of growth hormone (GH) into the bloodstream.</p>Formula:C149H246N44O42S·C2H4O2Purezza:Min. 95%Peso molecolare:3,417.94 g/mol16:0-23:2 Diyne pe
CAS:<p>Diynes are a group of unsaturated fatty acids that have two carbon-carbon double bonds. 16:0-23:2 Diyne pe is a growth factor that has been shown to increase the proliferation of prostate cancer cells in vitro. It has also been shown to stimulate angiogenesis, or the formation of new blood vessels from pre-existing ones. It has been found to be an important prognostic factor for cervical cancer and may be used as a predictive marker for prognosis and treatment. This compound is present in human serum at low levels and is increased by liver damage, inflammation, or other diseases such as hepatitis. 16:0-23:2 Diyne pe may also play a role in preeclampsia and cell culture, where it stimulates cell proliferation. In addition, this compound may act as a receptor for fatty acid metabolism.</p>Formula:C44H80NO8PPurezza:Min. 95%Peso molecolare:782.08 g/molVasopressin
CAS:<p>Vasopressin receptor agonist; antidiuretic</p>Formula:C46H65N15O12S2Purezza:Min. 95%Colore e forma:White PowderPeso molecolare:1,084.23 g/molBenzoylecgonine antibody
<p>Benzoylecgonine antibody was raised in mouse using benzoyl ecgonine-BSA as the immunogen.</p>Purezza:Min. 95%Z-VRPR-FMK trifluoroacetate
CAS:<p>Z-VRPR-FMK trifluoroacetate is an apoptosis-inducing inhibitor that works by inhibiting a specific kinase in the human body. It has been shown to have anti-cancer properties and may be useful in the treatment of various types of cancer. Z-VRPR-FMK trifluoroacetate is a menthol analog that acts as an inhibitor of apoptosis, which is the process by which cells die naturally. This compound has been tested on Chinese hamster ovary cells and has been found to be effective at inducing apoptosis in these cells. Additionally, Z-VRPR-FMK trifluoroacetate has been shown to inhibit tylosin-induced apoptosis in human colon cancer cells. Overall, this compound shows promise as a potential therapeutic agent for the treatment of cancer and other diseases.</p>Formula:C34H50F4N10O9Purezza:Min. 95%Peso molecolare:818.8 g/mol5-azido-pentanoyl-RKKRRQRRR-NH2 TFA salt
<p>Peptide 5-azido-pentanoyl-RKKRRQRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.</p>Colore e forma:PowderPeso molecolare:1,463.78 g/molCefuroxime-d3
CAS:<p>Cefuroxime-d3 is intended for use as an internal standard for the quantification of cefuroxime, FA19881. Cefuroxime is a cephalosporin antibiotic with broad-spectrum activity against Gram-positive and Gram-negative bacteria.</p>Formula:C16H16N4O8SPurezza:Min. 95%Peso molecolare:427.4 g/molALX-1393
CAS:<p>ALX-1393 is a synthetic compound that acts as an inhibitor, specifically targeting the glycine transporter 1 (GlyT1). As a small molecule inhibitor derived from chemical synthesis, it modulates neurotransmitter systems by blocking the reuptake of glycine, an important co-agonist of the NMDA receptor, in the central nervous system. The mode of action of ALX-1393 involves binding to the GlyT1 transporter, thereby increasing the synaptic concentration of glycine. This elevation in glycine levels enhances NMDA receptor function, which is crucial for synaptic plasticity, learning, and memory.</p>Formula:C23H22FNO4Purezza:Min. 95%Peso molecolare:395.4 g/molSecologanate
CAS:<p>Secologanate is a peptide that has been used as a research tool to study the interactions between proteins and ligands. Secologanate is an inhibitor of ion channels, which are membrane-spanning proteins that control the flow of ions in and out of cells. It also inhibits protein interactions by blocking the binding site on one molecule for a second molecule. Secologanate has been shown to inhibit the ion channel TRPV1, which is involved in pain sensation. Secologanate has also been shown to be a ligand for the human angiotensin II receptor type 1 (AT1R).</p>Formula:C16H22O10Purezza:Min. 95%Peso molecolare:374.34 g/molCYFRA21-1 antibody
<p>The CYFRA21-1 antibody is a powerful tool in the field of Life Sciences. This antibody specifically targets fibronectin, a protein involved in cell adhesion and migration. It has cytotoxic properties, making it useful for studying cellular processes and identifying potential therapeutic targets. Additionally, the CYFRA21-1 antibody can be used to detect inhibitory factors or antiphospholipid antibodies in biological samples. It is also effective in detecting insulin antibodies, autoantibodies, and antibodies involved in glycosylation processes. With its high specificity and sensitivity, this monoclonal antibody is an invaluable tool for researchers looking to uncover new insights into various biological pathways and disease mechanisms.</p>Faradiol 3-laurate
CAS:Prodotto controllatoFaradiol 3-laurate is an analog that has been shown to induce apoptosis in cancer cells. It is a promising compound for the treatment of tumors due to its ability to inhibit proteins that are involved in cancer cell growth and survival. Faradiol 3-laurate has been found in medicinal plants and human urine, and has been used as a Chinese traditional medicine for centuries. This compound is also a potent inhibitor of kinases, which are enzymes that play a critical role in the regulation of cellular processes such as cell growth and differentiation. Its anticancer properties make it an attractive candidate for further research in the development of novel cancer therapies.Formula:C42H72O3Purezza:Min. 95%Peso molecolare:625 g/molCyclo(L-alanyl-L-tryptophyl) trifluoroacetate
CAS:<p>Please enquire for more information about Cyclo(L-alanyl-L-tryptophyl) trifluoroacetate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C14H15N3O2•(C2HF3O2)xPurezza:Min. 95%Peso molecolare:257.29 g/molcis-Benvitimod
CAS:<p>Aryl hydrocarbon receptor (AhR) agonist</p>Formula:C17H18O2Purezza:Min. 95%Peso molecolare:254.32 g/molTPCN1 Blocking Peptide
<p>A synthetic peptide for use as a blocking control in assays to test for specificity of TPCN1 antibody, catalog no. 70R-5158</p>Purezza:Min. 95%Progesterone 3 antibody
<p>Progesterone-3 antibody was raised in sheep using 17-OH-Progesterone-3-BSA as the immunogen.</p>Purezza:Min. 95%Pseudoisoeugenyl 2-methylbutyrate
CAS:<p>Pseudoisoeugenyl 2-methylbutyrate is an analog of astaxanthin that has shown promising results in inhibiting tumor growth and inducing apoptosis in cancer cells. It acts as a kinase inhibitor, preventing the replication of cancer cells and promoting anticancer effects. Pseudoisoeugenyl 2-methylbutyrate has been tested on human and Chinese hamster ovary cell lines, demonstrating its potential as a potent anticancer agent. This compound has also been found in urine samples, suggesting that it may have natural sources in the body. Its ability to inhibit kinases makes it a promising candidate for further research into cancer treatment.</p>Formula:C15H20O3Purezza:Min. 95%Peso molecolare:248.32 g/mol4-[3-[5-Amino-2-(2-furanyl)-7H-pyrazolo[4,3-e][1,2,4]triazolo[1,5-c]pyrimidin-7-yl]propyl]phenol
CAS:<p>Please enquire for more information about 4-[3-[5-Amino-2-(2-furanyl)-7H-pyrazolo[4,3-e][1,2,4]triazolo[1,5-c]pyrimidin-7-yl]propyl]phenol including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C19H17N7O2Purezza:Min. 95%Peso molecolare:375.4 g/molN-(5-Aminopentyl) methotrexate amide-LC-biotin
<p>N-(5-Aminopentyl) methotrexate amide-LC-biotin is a specialized bioconjugate, derived through the conjugation of methotrexate, an established antifolate drug, with an LC-biotin moiety. This product is synthesized by covalently linking methotrexate, which is known for its role in cancer therapy through the inhibition of dihydrofolate reductase (DHFR), to a biotin moiety via a long-chain spacer. The resultant bioconjugate retains the therapeutic effects of methotrexate, particularly in its ability to interrupt nucleotide synthesis, thereby affecting cell division in rapidly proliferating cancer cells.The inclusion of biotin in the structure allows for facile attachment to avidin or streptavidin-labeled systems, facilitating targeted delivery and enhanced detection in molecular and cellular studies. The primary application of N-(5-Aminopentyl) methotrexate amide-LC-biotin lies in the realm of targeted drug delivery and advanced research into methotrexate metabolism. By leveraging the high affinity of biotin-streptavidin interactions, researchers can effectively study the biodistribution and cellular uptake of methotrexate, advancing cancer therapeutic strategies and providing insights into antifolate drug mechanisms at the molecular level.</p>Formula:C41H59N13O7SPurezza:Min. 95%Colore e forma:PowderPeso molecolare:878.06 g/molBromantane-d5
CAS:Prodotto controllato<p>Please enquire for more information about Bromantane-d5 including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C16H20BrNPurezza:Min. 95%Peso molecolare:311.27 g/molCys-Gly-3M3SH
CAS:<p>Cys-Gly-3M3SH is a cationic antimicrobial peptide that has been shown to be effective against Staphylococcus aureus. Cys-Gly-3M3SH binds to the bacterial enzyme urease, which is responsible for converting urea into ammonia and carbon dioxide. The binding of this peptide prevents the hydrolysis of urea, leading to cell death by disruption of the proton motive force. Cys-Gly-3M3SH is also biotransformed by bacteria in humans and can be used as a probe for transport studies in vitro. It can also be used as a molecular probe for structural biology research, such as protein crystallization and electron microscopy studies.</p>Formula:C12H24N2O4SPurezza:Min. 95%Peso molecolare:292.39 g/molCortisol antibody
<p>Cortisol antibody was raised in mouse using cortisol-3 BSA as the immunogen.</p>CRT-0066101 hydrochloride
CAS:<p>Crt0066101 hydrochloride is a peptide that has been shown to inhibit the activity of receptors for the neurotransmitter acetylcholine. It binds to the receptor and blocks access by acetylcholine, which prevents activation of the receptor. Crt0066101 hydrochloride is a ligand that inhibits ion channels in cells, including potassium channels, calcium channels, and sodium channels. This drug can be used as a research tool to study protein interactions in cell biology and pharmacology as well as to identify new drugs with potential therapeutic benefits. Crt0066101 hydrochloride is an inhibitor of G-protein coupled receptors (GPCRs) that has been shown to block the activation of muscarinic receptors on heart tissue. It also inhibits calcium-activated potassium channels on smooth muscle cells, leading to reduced blood pressure in animal models.</p>Formula:C18H22N6OHClPurezza:Min. 95%Colore e forma:SolidPeso molecolare:411.33 g/molHYYYGAAPPGQKGQANATRIPAKTPPAPK{pT}PPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLP{pT}PPTREPKKVA-OH
<p>Please enquire for more information about HYYYGAAPPGQKGQANATRIPAKTPPAPK{pT}PPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLP{pT}PPTREPKKVA-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purezza:Min 80%Pheromone Biosynthesis Activating Neuropeptide (Helicoverpa assulta, Heliothis zea)
CAS:Please enquire for more information about Pheromone Cymit Quimicaesis Activating Neuropeptide (Helicoverpa assulta, Heliothis zea) including the price, delivery time and more detailed product information at the technical inquiry form on this pageFormula:C167H259N47O57S2Purezza:Min. 95%Peso molecolare:3,901.26 g/mol1-Oleoyl-2-docosahexaenoyl phosphatidylcholine
CAS:<p>1-Oleoyl-2-docosahexaenoyl phosphatidylcholine is a fatty acid derived from the biogenesis of phosphatidylcholine, which is an important component of all cell membranes.</p>Formula:C48H82NO8PPurezza:Min. 95%Peso molecolare:832.14 g/molKeyphos(R)
CAS:<p>Keyphos is a homogeneous catalyst that can be used in selective reductive elimination reactions. Keyphos is stable and has a long shelf life, making it an ideal candidate for scalable synthesis. It can also be used with halides, amines, and organometallic reagents to produce functionalized products. This catalytic compound has been shown to reduce the reaction time of palladium-catalyzed coupling reactions by up to 50%.</p>Formula:C32H58P2Purezza:Min. 95%Peso molecolare:504.75 g/molRef: 3D-PAA18594
5gPrezzo su richiesta10gPrezzo su richiesta25gPrezzo su richiesta50gPrezzo su richiesta100gPrezzo su richiestaCoibamide A
CAS:<p>Please enquire for more information about Coibamide A including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Formula:C65H110N10O16Purezza:Min. 95%Peso molecolare:1,287.65 g/molN-Desethyl N-methyl rivastigmine
CAS:N-Desethyl N-methyl rivastigmine is an analog of rivastigmine and a potent inhibitor of kinases. It has been shown to induce apoptosis in cancer cells, making it a promising candidate for the treatment of various types of tumors. This medicinal compound is excreted through urine and has been found to have anticancer properties by inhibiting protein kinases. In Chinese hamster ovary cells, N-Desethyl N-methyl rivastigmine was found to inhibit the activity of several kinases involved in cell proliferation and survival. This inhibitor has potential therapeutic applications for cancer treatment due to its ability to target specific kinases that are essential for tumor growth and progression.Formula:C13H20N2O2Purezza:Min. 95%Peso molecolare:236.31 g/mol(3,4-Dihydro-2(1H)-isoquinolinyl)[2-[(4-methoxyphenyl)amino]-4-thiazolyl]methanone
CAS:<p>3,4-Dihydro-2(1H)-isoquinolinyl)[2-[(4-methoxyphenyl)amino]-4-thiazolyl]methanone is a potent and selective inhibitor of the ion channel TRPM8. It reduces pain and inflammation by inhibiting the action of TRPV1 and TRPA1. 3,4-Dihydro-2(1H)-isoquinolinyl)[2-[(4-methoxyphenyl)amino]-4-thiazolyl]methanone is an inhibitor of the TRPM8 ion channel with IC50 value of 0.06 μM. 3,4-Dihydro-2(1H)-isoquinolinyl)[2-[(4-methoxyphenyl)amino]-4-thiazolyl]methanone inhibits TRPA1 with IC50 value of</p>Formula:C20H19N3O2SPurezza:Min. 95%Peso molecolare:365.5 g/molFoslevodopa
CAS:<p>Foslevodopa is a prodrug that is converted to levodopa in the body. This drug has been shown to be safe and effective for the treatment of Parkinson's disease with minimal side effects, although it does not affect the progression of the disease. Foslevodopa is a synthetic compound that has been synthesized using chemical methods. It can be manufactured in large quantities, making it a scalable pharmaceutical formulation.</p>Formula:C9H12NO7PPurezza:Min. 95%Peso molecolare:277.17 g/mol1,2-Dipalmitoyl-3-dimethylammonium-propane
CAS:<p>1,2-Dipalmitoyl-3-dimethylammonium-propane is a cationic lipid, which is a type of synthetic lipid commonly used in biochemical and biophysical research. It is sourced from chemical synthesis, involving the formulation of lipid molecules with specific chemical modifications to confer particular properties. The mode of action of this compound involves its ability to integrate into lipid bilayers and form liposomes. These liposomes can encapsulate nucleic acids, facilitating their delivery into cells by merging with cell membranes, which is crucial for gene delivery applications.</p>Formula:C37H73NO4Purezza:Min. 95%Peso molecolare:595.98 g/molMyristoyl pentapeptide-17 hydrochloride
CAS:Myristoyl Pentapeptide-17 is a synthetic peptide used for the promotion of eyelash growth in cosmetic industry.Formula:C41H81N9O6•(HCl)xCAY10727
CAS:<p>CAY10727 is a potent biochemical inhibitor, which is derived from synthetic sources with specific action targeting cyclooxygenase-2 (COX-2) enzymes. It functions by selectively blocking the enzymatic activity of COX-2, which plays a critical role in the biosynthesis of prostaglandins involved in inflammatory responses. This targeted inhibition allows the study of COX-2-related pathways without interference from COX-1, which is significant for maintaining gastrointestinal integrity.The use and applications of CAY10727 are primarily in research settings where understanding the pathways involved in inflammation, pain, and cancer progression are critical. This compound is utilized in various in vitro experiments to delineate the role of COX-2 in cellular and molecular contexts, enabling scientists to dissect complex signaling networks. Given its specificity, CAY10727 is instrumental in the development of new therapeutic approaches where selective COX-2 inhibition might offer benefits over non-selective inhibitors.</p>Formula:C21H22Cl2N4O2Purezza:Min. 95%Peso molecolare:433.3 g/mol
![[D-Ala2]-beta-Casomorphin (1-3) amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00827.webp&w=3840&q=75)
![[D-Ala2] Deltorphin II](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00826.webp&w=3840&q=75)
![[Tyr0] Gastric Inhibitory Peptide (23-42), human](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00928.webp&w=3840&q=75)
![[Ala4]-MBP (1-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00021.webp&w=3840&q=75)
![[Lys0]-γ-1-MSH (41-58), amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00561.webp&w=3840&q=75)
![[Ile-Ser]-Bradykinin (T-Kinin)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00511.webp&w=3840&q=75)
![[Arg8]-Vasotocin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00302.webp&w=3840&q=75)
![[D-Tyr11]-Neurotensin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00160.webp&w=3840&q=75)
![[Pyr6]-Substance P (6-11)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00172.webp&w=3840&q=75)
![[D-Pro194]-IL-1 beta (193-195) (human)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00516.webp&w=3840&q=75)
![[Val35] -beta-Amyloid (1-42)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00311.webp&w=3840&q=75)
![[Cys0]-GTP-Binding Protein Gsa (28-42)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00280.webp&w=3840&q=75)
![[D-Trp8,D-Cys14]-Somatostatin-14](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00216.webp&w=3840&q=75)
![[Tyr1]-pTH (1-34) (rat)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00930.webp&w=3840&q=75)
![[Cys(Acm)20,31]-EGF (20-31)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00265.webp&w=3840&q=75)
![[D-Ser13]-Somatostatin-14](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00217.webp&w=3840&q=75)
![[Sar1]-Angiotensin I/II (1-7) amide](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00205.webp&w=3840&q=75)
![[Tyr11]-Somatostatin-14](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00219.webp&w=3840&q=75)
![[D-Ala2,Leu5,Arg6] Enkephalin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00837.webp&w=3840&q=75)
![[Nle13]-Motillin](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00402.webp&w=3840&q=75)
![[Met5, Lys6, Arg7] a-Neo-Endorphin (1-7)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00876.webp&w=3840&q=75)
![[Pro18, Asp21] beta-Amyloid (17-21), iAb5](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00575.webp&w=3840&q=75)
![[D-Pro2,D-Phe7,D-Trp9]-Substance P](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00653.webp&w=3840&q=75)
![[Glu10]-ACTH (1-17)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00755.webp&w=3840&q=75)
![[Met5, Lys6] a-Neo-Endorphin (1-6)](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00875.webp&w=3840&q=75)
![[Des-Gln16]-PACAP (6-27), amide, human, ovine, rat](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FVAC-00400.webp&w=3840&q=75)
![1-(Carboxymethyl)-1H-benzo[G]indole-2-carboxylic acid](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FAAC27331.webp&w=3840&q=75)
![3-Amino-6,7,8,9-tetrahydro-5H-1-thia-10-aza-cyclohepta[f]indene-2-carboxylic acid (5-phenyl-[1,3,4…](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FARA86377.webp&w=3840&q=75)
![4-[3-[5-Amino-2-(2-furanyl)-7H-pyrazolo[4,3-e][1,2,4]triazolo[1,5-c]pyrimidin-7-yl]propyl]phenol](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FNHA11292.webp&w=3840&q=75)
![(3,4-Dihydro-2(1H)-isoquinolinyl)[2-[(4-methoxyphenyl)amino]-4-thiazolyl]methanone](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FLEB94596.webp&w=3840&q=75)
