Peptidi

Peptide H-SDAPIGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Β-sheet amyloid aggregate peptide is a short peptide that has been shown to form β-sheet amyloid aggregates in vitro. Proteins that contain such sequences are likely to be problematic for a cell, due to their potential to aggregate into toxic structures. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-RP^QQPYPQPQPQY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-REPLACE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IL^DTAGREEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ELL^ETGDNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-YGGFLRRIR^PKLKWDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-FYFENLLAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LQDVHNFVALGAPLAPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SANSNP^AMAPRERKAGCKNFFWKTFTSC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-RKKRRQRRR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-RARADADARARADADA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-ARTKQTARKSTG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Glycine proline (Gly-Pro) dipeptide is a bioactive collagen hydrolysate. Ingestion of collagen hydrolysate improves skin health. Gly-Pro ingestion specifically attenuates UVB-induced damage including wrinkle formation, trans-epidermal water loss, and epidermis thickness- Gly-Pro also increases skin hydration.

Peptide DTrp-Gamma MSH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Protease activated receptors (PARs) are a distinctive four-member family of seven transmembrane G protein-coupled receptors (GPCRs) widely expressed in inflammatory cells. PARs are cleaved by certain serine proteases to expose a tethered ligand domain, this ligand domain then binds to and activates the receptors to initiate multiple signalling cascades. These PAR-activating proteases therefore represent PAR agonists. This PAR-1 agonist peptide represents the sequence of the 'tethered ligand' and is therefore capable of activating the receptor independently of N-terminal proteolysis. TFLLR-NH2 is more selective to PAR-1 than the PAR-1 agonist SFLLRN-NH2.Activation of PAR-1 induces platelet aggregation and IL-6 release from monocytes and T cells, as well as several other cellular pathways including those involved in allergic inflammation, neurogenic inflammation and the potentiation of NMDA receptor activity in the hippocampus.

Peptide Ac-NQSYQYGPSSAGNGAGC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Z-Val-Met-OH is a high purity synthetic compound that can be used as a research tool in cell biology, ion channels and peptides. This compound is an activator of the receptor for bradykinin and has been shown to inhibit the activity of protein kinase C. Z-Val-Met-OH is also a ligand for the acetylcholine receptor and has been shown to inhibit acetylcholinesterase, leading to an increase in acetylcholine levels. Z-Val-Met-OH binds to the receptor for insulin and can be used as an inhibitor of insulin release from pancreatic beta cells.

Peptide H-VEHWGL^DEPL^LK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TFERRN-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-RTVAAPSVFIFPPSDEQLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DVNAAIAAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LFDSLTLLASGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-WQEEMELYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

SK channel blocker

Boc-Trp(CHO)-OH is a peptide that is an activator of the ion channel TRPV1. It binds to the receptor for capsaicin and then causes a conformational change in the receptor protein, which leads to activation of the ion channel. Boc-Trp(CHO)-OH is used as a research tool in pharmacology, cell biology, and antibody production. This peptide can be synthesized with high purity and has been shown to have inhibitory effects on TRPV1 channels.

Teduglutide is a Glucagon-like Peptide-2 Analog which has been used in the treatment of Short Bowel Syndrome. It is avaiable in the Trifluoroacetate salt form.
One-Letter Formula: HGDGSFSDEMNTILDNLAARDFINWLIQTKITD

Peptide Ac-PAVLQSSGLYSLSSVVTVPSSSLGTQ-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VDTVDPPYPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

[Dap3]-Ghrelin (Rat) is an analog of the peptide hormone Ghrelin and is a growth-hormone releasing peptide. Ghrelin has various effects on the body, including stimulating appetite, nutrient sensing and meal initiation. It has also been found to regulate insulin resistance, diabetes and obesity and asserts its functional affects through acting as an endogenous ligand for the growth hormone secretagogue receptor (GHS-R). Its wider functions such as glucose homeostasis, energy homeostasis, cardio-protective effects, its role in bone metabolism and its potential to be a target for cancer means that it can be used to develop therapies for a whole spectrum of diseases.

Peptide H-DHSAIPVINR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-NNLEAL^EDFEK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Pro-Pro-Gly is a research tool that is used as an activator, ligand, or receptor in cell biology. Pro-Pro-Gly contains a Gly residue at the end of the peptide chain. It can be used to inhibit ion channels and can be synthesized using a high purity technique. Pro-Pro-Gly has been shown to have the ability to bind to antibodies and other proteins, which may be used for pharmacological purposes.

H-KLVVVGACGV-OH is a custom research peptide; min purity 95%, TFA salt. For different specs please use the Peptide Quote Tool

Peptide H-GTVSGTL^^IGLEFIR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-EIPVESIEEVSK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-QQTVGGVNYFFDVEVGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Aoa-ATCYCRTGRCATRESLSGVCEISGRLYRLCCR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TYLPAVDEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GQSIQPFISR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-CKSLLWKKVLP-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DPK^PIPGNW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VSSLPSVTLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FKDLGEENFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

A synthetic AT2 Blocking peptide for use as a blocking control in assays to test for specificity of AT2 antibody, catalog no. 70R-AR006

Peptide H-LGVSCEVIDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YGGFLRRIRPKLK^WDNQ-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SFEDIHHYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide Ac-RHRK-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

H-Gly-Arg-Gly-Glu-Ser-OH is a monoclonal antibody that binds to the integrin receptor on the surface of fibroblasts. It has been shown to inhibit the angiogenic process in vitro, by reducing the expression of growth factors β1 and VEGF. This antibody also inhibits collagen gel contraction and membrane interactions. The detection time for this antibody is approximately 5 days.

CHKtide is a synthetic peptide substrate for checkpoint-kinase-1 and 2 (CHK1/CHK2) as well as salt-inducible kinase (SIKs) for use in kinase assays. CHKtide has been derived from CDC25C which is phosphorylated by CHK1/CHK2 in one of the DNA repair pathways. SIKs are serine/threonine kinases that are part of a complex network that regulate sodium homeostasis and blood pressure.The serine residue at position 5 of this peptide has been phosphorylated.

Boc-Arg(NO2)-OH is an activated molecule that is used as an anticoagulant. It inhibits the serine protease, which has an inhibitory effect on heparin-induced thrombocytopenia, and also inhibits platelet aggregation. Boc-Arg(NO2)-OH has been shown to have a potent inhibition of the enzyme that converts prothrombin into thrombin. This effect can be reversed by adding protamine sulfate. The clinical data suggest that this drug may be beneficial for patients with severe or life-threatening conditions who are taking heparin therapy or undergoing surgery and need anticoagulation. The prognosis of this drug is unclear, but it appears to be safe when administered in conjunction with other medications such as aspirin and warfarin.

Peptide H-STVHEILCKLSLEG-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-MYWVRQAPGKGLEW-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GVPAEGAFTEDFQGLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YEVSSPYFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-WFYIASAFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-QDGNEEM-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FNWYVDGVEVHNAKTKPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FQPTLLTLPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VFTPLEVDVAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Fluor-REDEDEIEW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Plasma membrane calcium pumps (PMCA) play integral roles in calcium homeostasis and calcium signalling. There are four PMCA isoforms (1-4), their expression and localisation are varied amongst cell types and diseased tissue. Therefore, identification of specific inhibitors of each PMCA is underway to aid understanding of the individual roles the PMCAs play. Use of phage libraries and mutagenesis has allowed rapid screening of possible peptides. A PMCA inhibitor of importance found by screening and mutagenesis is caloxin 1C2. Caloxin 1C2 has been shown to have a 10 found higher affinity for PMCA4 than any other isoforms suggesting it is a suitable selective inhibitor for PMCA4 activity. The allosteric inhibitor is already being used in research to help understand the specific function of PMCA4 in tissues. Since changes in the levels of activity and expression of the PMCA isoforms have been linked to several conditions, such as hypertension and diabetes, clarifying the function of PMCA4 with the use of caloxin1C2 inhibitor could provide new treatments in the future.

Peptide H-R^TPDYFL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DFSIWEETGLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VVPCEPPEV^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Colivelin is a peptide that can be found in the central nervous system. It has been shown to have a wide variety of biological activities, including being an inhibitor of neuronal death, enhancing axonal growth and proliferation, and decreasing the activity of signal pathways. Colivelin has also been shown to inhibit the proliferation of human osteosarcoma cells by binding to their cell surface receptors.

Peptide H-IAPQLSTEELVSLGEK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-DHLASLWWGTEL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Abz-Gly-Phe(NO2)-Pro-OH is a peptide that has been shown to have antihypertensive activity. It also has radical scavenging properties, and it can be used as an amino acid composition marker. Abz-Gly-Phe(NO2)-Pro-OH has been shown to inhibit the growth of faecalis and subtilis, which are both Gram positive bacteria. The peptide has also been shown to have inhibitory properties against proteolytic enzymes from bovine casein, human serum and rat blood pressure.

Peptide H-DRV^YIHP-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-GQLIDSMANSFVGTR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DPTFIPAPIQAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Boc-Ala-OH is a peptide that is used in the treatment of skin cancer. It has been shown to have antitumor properties, as well as antiviral and antifungal effects. Boc-Ala-OH has been shown to inhibit proteolytic enzymes, such as collagenase and elastase, which are involved in the development of inflammatory diseases. This peptide also binds to human serum albumin with high affinity, which may be an important factor in its therapeutic effect. Boc-Ala-OH inhibits the enzyme activities of neutrophils by binding to their membranes and changing the permeability of these cells, which causes them to release cytotoxic granule contents. This peptide also inhibits squamous cell carcinoma and other types of cancerous cells.

Boc-D-Arg(Tos)-OH is an analytical grade building block for the synthesis of D-amino acids. It is used as a reagent for the synthesis of Boc-protected D-amino acids and as a precursor to other amino acid derivatives. The chemical name is N-[2,6-diaminopimeloyl]glycine ethyl ester hydrochloride. Boc-D-Arg(Tos)-OH is soluble in ethyl acetate and methanol, but not in water or ethanol. This product can be used to synthesize peptides with desired properties.

Peptide H-EFTPPVQAAYQK^^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VSPGAFTPLVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Boc-Pro-OH is a synthetic amino acid that is used in the preparation of samples for gas chromatography. Boc-Pro-OH has antiinflammatory activity, and can be used to treat cancer. It is also used as an intermediate in the synthesis of amides, which are important in pharmaceuticals. Boc-Pro-OH is soluble in water and carbonate buffer solutions, but insoluble in ethanol. The chemical structure of this molecule is unusual because it contains a Boc group.

Boc-D-Lys(Cl-Z)-OH is a synthetic peptide that has been shown to bind to the activator region of the human epidermal growth factor receptor (EGFR). It has also been shown to inhibit ion channels and activate ligand-gated ion channels. This product is a research tool for use in cell biology, pharmacology, and other life science research. Boc-D-Lys(Cl-Z)-OH can be used as an antibody or ligand for a receptor, as well as an inhibitor for protein interactions.

Peptide H-VDATEESDLAQQYGVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Cbz-LR-AMC is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Siastatin B is a peptide that can be used as a research tool for studying protein interactions. It has been shown to be an activator of ligand-gated ion channels, such as nicotinic acetylcholine receptors and glutamate receptors. Siastatin B also binds to the neurotoxin receptor, which leads to the inhibition of the binding of neurotoxins to this receptor. The inhibitory activity of siastatin B is reversible and competitive with respect to the neurotoxin receptor. Siastatin B also inhibits cell proliferation at high concentrations.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

TCTU Reagent is a coupling reagent that is used to synthesize peptides. TCTU Reagent is a building block for peptide synthesis, which can be used to produce peptides of different lengths. TCTU Reagent also has the ability to condense two amino acids together in sequence to form a dipeptide. This reagent has been shown to be compatible with most amino acids, except glycine and tryptophan, and can be used for both automated or manual peptide syntheses.

Fmoc-Met-Rink-Amide MBHA Resin is a peptide that can be used as an activator for antibodies, research tool for ion channels and life science. It has high purity and is a CAS No. The resin is an inhibitor for protein interactions and can be used to study pharmacology.

Peptide Biot-PKPPKPVSKMRMATPLLMQA-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

H-Arg-Lys-OH acetate salt is a cyclic peptide that has been shown to have antimicrobial activity. It is an immunomodulator that has been shown to reduce the progression of autoimmune diseases by regulating the production of IgG, IgM and IgA. This drug is also a potent inhibitor of 2-adrenergic receptors in neuro2a cells and inhibits the release of IGF-I. H-Arg-Lys-OH acetate salt has been shown to be effective against infectious diseases such as meningitis, bronchitis, and pneumonia. It also inhibits proteolytic enzymes produced by bacteria, which may result in tissue damage.

PAMP-12 is a peptide that can activate the human immune system. It can be used as a research tool for studying protein interactions and receptor ligand pharmacology. PAMP-12 is an inhibitor of ion channels, which are proteins that regulate the flow of ions through cell membranes. The CAS number for this peptide is 196305-05-2.

Peptide H-LIFAGKQLEDGR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

TentaGel® R RAM Resin (90 um), Rink-type can be used for the preparation of peptide amides (Rink-type) (90 µm) 018-022 meq/g and is specially designed for difficult and long sequences.
TentaGel, is a gelatinous resin, an important support for solid phase synthesis. TentaGel resins are constructed with a backbone of low crosslinked polystyrene grafted with polyoxyethylene (polyethylene glycol) as shown below. The typical chain length of POE (n) is approximately 68 ethylene oxide units or an average MW of 3000. This long chain creates a spacer that effectively separates the reactive site (X) from the crosslinked backbone matrix.

Gly-Pro is a cyclic peptide that binds to DPP-IV and inhibits proteolytic activity. It has been shown to have inhibitory properties against infectious diseases and cancer tissues, as well as a fluorescence probe for the detection of DPP-IV. Gly-Pro is also a potential inhibitor of neuronal death and has been shown to have structural analysis in the form of molecular docking analysis.

Peptide H-SILLTEQALAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SDLVNEEATGQFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VGGHAAEYGAEAL^ER-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide LCBiot-KKVAVVRTPPKSPSSAKSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-AYPDANLLNDR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide LCBiot-RRRRRRRRR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Src Homology 2 Domain (Biotinylated) is a peptide that binds to the SH2 domain, which is a part of the Src family of kinases. This domain is important for cell signaling. The peptide can be used as a ligand in research or as a probe to detect and map protein-protein interactions. It can also be used to measure the activity of kinases and measure changes in protein-protein interactions. The peptide contains an N-terminal biotin tag, which allows it to be detected using streptavidin conjugated to an enzyme substrate, such as horseradish peroxidase.

Peptide Ac-HWRGWVC-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VL^AVTDSPAR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GEPGPAGAVGP^AGAVGPR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-KLLMVLML^A-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Boc-γ-Abu-OH is a model drug used in peptide synthesis. It is a building block that can be used to form the amino acid γ-Abu. This amino acid has an unusual β-amino group, which is coupled with the Boc group using photorelease chemistry. The resulting compound can be used as a building block for dendrimer or convergent syntheses.
Boc-γ-Abu-OH reacts with dimethoxybenzene and dendron to form γ-Abu. The resulting product can be reacted with other molecules, such as diamines and benzyl halides, to produce analogues of γ-Abu. This process allows for the synthesis of new compounds that have not been previously reported in the literature.

Peptide H-ESTLHLVLRLR^GG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide LCBiot-LPETGG-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LSALTPSPSWLKYKAL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-MVTGVASALSSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FQSVFTVTR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SLETEILESLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-GGPLDGTYR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-IPLENLQIIR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Fmoc-γ-Abu-OH is a fatty acid that belongs to the group of neurotrophic factors. It has been shown to have neuroprotective properties in vitro and in vivo, and its mechanism may be related to its inhibition of apoptotic cell death. Fmoc-γ-Abu-OH also has pharmacokinetic properties, which are dependent on the route of administration. This compound is absorbed through the gastrointestinal tract and distributed throughout the body with a half-life of approximately 12 hours. Fmoc-γ-Abu-OH binds to β-catenin and inhibits its degradation by proteasomes, thereby increasing its levels in cells.

Peptide H-QPR^GRILGGQE-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TAFDEAIAELDTLSEESYK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DYWSTVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LVLPEYGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-MYNPTNILDVK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YLGYLEQLLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-IAQLEEQLDNETK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-LHVDPENFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SISIVGSYVGNR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Fluor-SIINFEKLGSGHWDFAWPW-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SV^EGSCGF-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-LEGR-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IDGLNVADIGLHDLR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide LCBiot-YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ALLAFQESK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YPIPPPDAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VEIIATMK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VLADEFIIPGLK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-AQLGDLPWQVAIK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Endothelin-1 is a peptide that acts as a vasoconstrictor and plays an important role in the regulation of blood pressure. Endothelin-1 is also an endogenous ligand for two G protein-coupled receptors, ETA and ETB. Interesting Endothelin-1 is the most abundant isoform and is expressed in endothelial cells of every blood vessel. It exerts its vasoconstrictor effects through binding to ETA receptors located on the smooth muscle. This product has disulfide bonds between Cys1-Cys15 and Cys3-Cys11 and is available as a 0.1mg vial.

Peptide H-WMDF-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VTMLISGR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-EAEAAMFHR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-SIIQFEKL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IQILEGWK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DGGAWGTEQR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-Kpy-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

ß-Endorphin, also known as Equine ß-Endorphin, is a polypeptide hormone that is a member of the endorphin family. It is a peptide consisting of nine amino acids. ß-Endorphin has been found in the pituitary gland and in other tissues in concentrations much higher than those of other endorphins. Beta-endorphin is thought to be involved in pain relief and stress relief.

Peptide H-TFPGFFSPMLGEFVSETESR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IGQLEEQLEQEAK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-IL^DTAGR^EEY-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-ISPLKSPYKISEGLC-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-DFDFVPPVVR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

K-252A is an antimicrobial agent that inhibits the growth of bacteria. It binds to the response element in the promoter region of genes and blocks gene transcription, thereby preventing protein synthesis. K-252A has been shown to inhibit the growth of bacteria that are resistant to many other antibiotics, including ampicillin, chloramphenicol, clindamycin, erythromycin, gentamicin and kanamycin. This drug also induces significant up-regulation of cyclic nucleotide phosphodiesterases (PDE) and cytosolic Ca2+ in vitro. K-252A has been shown to cause neuronal death in vitro by inhibiting axonal growth. K-252A also inhibits leukemia inhibitory factor (LIF) from binding to its receptor on mouse lymphocytes.

Peptide H-GSPAINVAVHVFR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-LLQDSVDFSLADAINTEFK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TPEVDDEALEK^FDK-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-SEPVSPPR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

CA-074 is a research tool that can be used to study protein interactions. CA-074 is a small, synthetic peptide and a potent inhibitor of the ion channel TRPC1. It has been shown to inhibit the calcium currents in HEK293 cells expressing TRPC1 channels. CA-074 inhibits the kinase activity of PLCγ2, which leads to reduced phosphoinositide levels and a decrease in cell proliferation. CA-074 also inhibits PKCδ and PKCε, which are members of the protein kinase C family.
The inhibition of these enzymes by CA-074 causes an increase in the intracellular concentration of diacylglycerol (DAG) and inositol triphosphate (IP3). These two molecules are involved in G protein signaling pathways that regulate cell proliferation, differentiation, and survival.

Peptide H-ALYVDSLFF^L-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-VVLAYEPVWAIGTGK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-TASSYFTNMFATWSPSKARL-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-NEQEQPL^GQWHL^S-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-YLIPNATQPESK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-FKDPNAPK^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-GIFPLAER^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide Ac-HTKQIPRHIYSA-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Fmoc-Pro-OH is a peptide that contains the Fmoc protecting group. It is used in the synthesis of peptides and has been shown to be effective against microbial infections with marine sponges. The synthesis of this compound can be carried out on an on-line automated peptide synthesizer. The Fmoc protecting group is removed by treatment with trifluoroacetic acid (TFA) in dichloromethane, which leaves the side chain unprotected. This compound has a high binding affinity for the receptor site of fibrinogen and can potentially inhibit the growth of bacteria that cause bacterial infection, such as Staphylococcus aureus and Pseudomonas aeruginosa.
Fmoc-Pro-OH can also be used to synthesize other functional groups such as sulfamoyl groups or acetonitrile groups, depending on the desired outcome.

Boc-D-Trp-OH is a trisubstituted, enantiomerically pure, excitatory amino acid. It has been shown to stimulate the release of neurotransmitters in the central nervous system and to have potent antitumor activity. Boc-D-Trp-OH is an unsaturated ketone that can be used as a building block for peptide synthesis. The disulfide bond present in this molecule may be reduced by the addition of DTT or DTE. This compound has also been shown to have cardiac hypertrophy inhibiting effects, due to its ability to inhibit PDE5 enzyme activity.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide LCBiot-IQKEIDRLNEVAKNLNESLI-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Peptide H-ADGVGK^SAL-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Enkephalins are a group of endogenous peptides that are the most potent natural analgesic and have been shown to relieve pain by inhibiting neurotransmitters. The (Met(O)5)-enkephalin analog is a structural analog of the enkephalin peptide with a sulfoxide linkage at position 5. This analog has been shown to inhibit acetylcholine release from intestinal ganglia, which may be related to its effects on postsynaptic potentials and glutamate release. This compound also absorbs in the small intestine, where it is taken into the blood stream and transported to the brain. The (Met(O)5)-enkephalin analog has been shown to reduce pain in Sprague-Dawley rats, as well as inhibit intestinal transit time and stimulate intestinal motility.

Amastatin is a synthetic product that inhibits peptidases. It is an inhibitor of the protease enzyme and can be used in the treatment of bladder infections caused by Chlamydia parvum. Amastatin has also been shown to inhibit Aminopeptidase, which is an enzyme that cleaves amino acids from proteins, thereby inhibiting protein synthesis. Amastatin has been shown to have an inhibitory effect on proteases in the striatal membranes of rats and may be useful in treating neurodegenerative disorders such as Parkinson's disease.

Peptide H-FQSGQVLAALPRTSR-NH2 is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Peptide H-IIWDSR^-OH is a Research Peptide with significant interest within the field academic and medical research. This peptide is available for purchase at Cymit Quimica in multiple sizes and with a specification of your choice.