Product Information
Name:CRF (human, rat)
Synonyms:
- Corticorelin
Brand:Bachem
Description:CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRH.
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Molecular weight:4757.52
Formula:C208H344N60O63S2
Purity:≥ 99%
Color/Form:White
Technical inquiry about: CRF (human, rat)
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
