CymitQuimica logo

CRF (human, rat)

CAS:

Ref. 01-4011473

1mg
375.00€
5mg
1,421.00€
CRF (human, rat)
Bachem

Product Information

Name:CRF (human, rat)
Synonyms:
  • Corticorelin
Brand:Bachem
Description:CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRH plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRH.
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Molecular weight:4757.52
Formula:C208H344N60O63S2
Purity:≥ 99%
Color/Form:White

Technical inquiry about: CRF (human, rat)

Please use instead the cart to request a quotation or an order

If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.