PIGF1 protein (His Tag)
Ref. 3D-30R-AP011
20µg
817.00€
Product Information
Name:PIGF1 protein (His Tag)
Brand:Biosynth
Description:LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAPRRTRHHHHHH
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Purity:Min. 95%
Technical inquiry about: PIGF1 protein (His Tag)
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.