CymitQuimica logo

PIGF1 protein (His Tag)

Ref. 3D-30R-AP011

20µg
Discontinued

Discontinued product. For inquiries about similar products, please fill out our form or email us at .

PIGF1 protein (His Tag)
Biosynth

Product Information

Name:PIGF1 protein (His Tag)
Brand:Biosynth
Description:LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAPRRTRHHHHHH
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Purity:Min. 95%

Inquiry about discontinued product: PIGF1 protein (His Tag)

◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.