CPS1 antibody
Ref. 3D-70R-1111
100µl
730.00€
Product Information
Name:CPS1 antibody
Brand:Biosynth
Description:
CPS1 antibody was raised using the N terminal of CPS1 corresponding to a region with amino acids QWLQEEKVPAIYGVDTRMLTKIIRDKGTMLGKIEFEGQPVDFVDPNKQNL
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Technical inquiry about: CPS1 antibody
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please add the desired products to your cart and manage the request from there. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.