CymitQuimica logo

EIF3M antibody

Ref. 3D-70R-1252

100µl
Discontinued

Discontinued product. For inquiries about similar products, please fill out our form or email us at .

EIF3M antibody
Biosynth

Product Information

Name:EIF3M antibody
Brand:Biosynth
Description:EIF3M antibody was raised using the N terminal of EIF3M corresponding to a region with amino acids MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACD
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Inquiry about discontinued product: EIF3M antibody

◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.