CymitQuimica logo

SLC1A5 antibody

Ref. 3D-70R-1769

1u
Discontinued
100µl
Discontinued

Discontinued product. For inquiries about similar products, please fill out our form or email us at .

SLC1A5 antibody
Biosynth

Product Information

Name:SLC1A5 antibody
Brand:Biosynth
Description:SLC1A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Inquiry about discontinued product: SLC1A5 antibody

◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.