CymitQuimica logo

SLC1A5 antibody

Ref. 3D-70R-1769

100µl
730.00€
SLC1A5 antibody
Biosynth

Product Information

Name:SLC1A5 antibody
Brand:Biosynth
Description:

SLC1A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV

Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Technical inquiry about: SLC1A5 antibody

Please use instead the cart to request a quotation or an order

If you want to request a quotation or place an order, please add the desired products to your cart and manage the request from there. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.