TMEM126B antibody
Ref. 3D-70R-1816
100µl | 697.00 € |
Product Information
TMEM126B antibody was raised using the middle region of TMEM126B corresponding to a region with amino acids VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC
Chemical properties
Technical inquiry about: 3D-70R-1816 TMEM126B antibody
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.