CymitQuimica logo

IL13RA2 antibody

Ref. 3D-70R-1949

100µl
Discontinued

Discontinued product. For inquiries about similar products, please fill out our form or email us at .

IL13RA2 antibody
Biosynth

Product Information

Name:IL13RA2 antibody
Brand:Biosynth
Description:IL13RA2 antibody was raised using the N terminal of IL13RA2 corresponding to a region with amino acids DHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLL
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Inquiry about discontinued product: IL13RA2 antibody

◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.