CymitQuimica logo

Influenza Virus Ns1A Binding Protein antibody

Ref. 3D-70R-2152

100µl
Discontinued

Discontinued product. For inquiries about similar products, please fill out our form or email us at .

Influenza Virus Ns1A Binding Protein antibody
Biosynth

Product Information

Name:Influenza Virus Ns1A Binding Protein antibody
Brand:Biosynth
Description:Influenza Virus Ns1A Binding Protein antibody was raised using the N terminal of IVNS1ABP corresponding to a region with amino acids RAVLACCSPYLFEIFNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLK
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Inquiry about discontinued product: Influenza Virus Ns1A Binding Protein antibody

◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.