
RCHY1 antibody
Ref. 3D-70R-2245
100µl
828.00€

Product Information
Name:RCHY1 antibody
Brand:Biosynth
Description:RCHY1 antibody was raised using the N terminal of RCHY1 corresponding to a region with amino acids KLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEY
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Technical inquiry about: RCHY1 antibody
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.