CymitQuimica logo

ATE1 antibody

Ref. 3D-70R-2256

100µl
Discontinued

Discontinued product. For inquiries about similar products, please fill out our form or email us at .

ATE1 antibody
Biosynth

Product Information

Name:ATE1 antibody
Brand:Biosynth
Description:ATE1 antibody was raised using the N terminal of ATE1 corresponding to a region with amino acids CCPQYTIRCRPLQFQPSKSHKKVLKKMLKFLAKGEVPKGSCEDEPMDSTM
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Inquiry about discontinued product: ATE1 antibody

◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.