SNRK antibody
Ref. 3D-70R-2565
100µl
841.00€
Product Information
Name:SNRK antibody
Brand:Biosynth
Description:
SNRK antibody was raised using the middle region of SNRK corresponding to a region with amino acids SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Technical inquiry about: SNRK antibody
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please add the desired products to your cart and manage the request from there. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.