POLQ antibody
Ref. 3D-70R-2978
100µl
828.00€
Product Information
Name:POLQ antibody
Brand:Biosynth
Description:POLQ antibody was raised using a synthetic peptide. The 14 aa immunogen is in this broader region: GHSFSFTSSDDIAEVLFLELKLPPNREMKNQGSKKTLGSTRRGIDNGRKL.
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Technical inquiry about: POLQ antibody
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.