CymitQuimica logo

RP11-529I10.4 antibody

Ref. 3D-70R-2999

100µl
747.00€
RP11-529I10.4 antibody
Biosynth

Product Information

Name:RP11-529I10.4 antibody
Brand:Biosynth
Description:RP11-529I10.4 antibody was raised using the middle region of RP11-529I10.4 corresponding to a region with amino acids APLGAGNLGPELIKESNANPIFMRKDTKMSFQWRIRNLPYPKDVYSVSVD
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Technical inquiry about: RP11-529I10.4 antibody

Please use instead the cart to request a quotation or an order

If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.