CymitQuimica logo

PUS10 antibody

Ref. 3D-70R-3290

100µl
Discontinued

Discontinued product. For inquiries about similar products, please fill out our form or email us at .

PUS10 antibody
Biosynth

Product Information

Name:PUS10 antibody
Brand:Biosynth
Description:PUS10 antibody was raised using the middle region of PUS10 corresponding to a region with amino acids AVFVAGRYNKYSRNLPQTPWIIDGERKLESSVEELISDHLLAVFKAESFN
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Inquiry about discontinued product: PUS10 antibody

◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.