CymitQuimica logo

PRAMEF10 antibody

Ref. 3D-70R-3366

1u
Discontinued
100µl
Discontinued

Discontinued product. For inquiries about similar products, please fill out our form or email us at .

PRAMEF10 antibody
Biosynth

Product Information

Name:PRAMEF10 antibody
Brand:Biosynth
Description:PRAMEF10 antibody was raised using the middle region of PRAMEF10 corresponding to a region with amino acids DLLRHTGGLSKLGLELYPAPLESLDYKGHVNWEILTPIRAELMRTLREVR
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Inquiry about discontinued product: PRAMEF10 antibody

◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.