ASB11 antibody
Ref. 3D-70R-3633
100µl | 762.00 € |
Product Information
ASB11 antibody was raised using the C terminal of ASB11 corresponding to a region with amino acids GQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSV
Chemical properties
Technical inquiry about: 3D-70R-3633 ASB11 antibody
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.