CymitQuimica logo

FAM53C antibody

Ref. 3D-70R-3662

100µl
Discontinued

Discontinued product. For inquiries about similar products, please fill out our form or email us at .

FAM53C antibody
Biosynth

Product Information

Name:FAM53C antibody
Brand:Biosynth
Description:FAM53C antibody was raised using the N terminal of FAM53C corresponding to a region with amino acids SNCGNSFQLVSEGASWRGLPHCSCAEFQDSLNFSYHPSGLSLHLRPPSRG
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Inquiry about discontinued product: FAM53C antibody

◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.