CymitQuimica logo

TBCB antibody

Ref. 3D-70R-3673

1u
Discontinued
100µl
Discontinued

Discontinued product. For inquiries about similar products, please fill out our form or email us at .

TBCB antibody
Biosynth

Product Information

Name:TBCB antibody
Brand:Biosynth
Description:TBCB antibody was raised using the C terminal of TBCB corresponding to a region with amino acids YDEPLGKNDGSVNGKRYFECQAKYGAFVKPAVVTVGDFPEEDYGLDEI
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Inquiry about discontinued product: TBCB antibody

◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.