CymitQuimica logo

Collagen Type IV alpha 3 antibody

Ref. 3D-70R-5733

100µl
Discontinued

Discontinued product. For inquiries about similar products, please fill out our form or email us at .

Collagen Type IV alpha 3 antibody
Biosynth

Product Information

Name:Collagen Type IV alpha 3 antibody
Brand:Biosynth
Description:Collagen Type IV alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Purity:Min. 95%

Inquiry about discontinued product: Collagen Type IV alpha 3 antibody

◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.