CymitQuimica logo

Mesothelin antibody

Ref. 3D-70R-6174_B

ne
Discontinued

Discontinued product. For inquiries about similar products, please fill out our form or email us at .

Mesothelin antibody
Biosynth

    Product Information

    Name:Mesothelin antibody
    Brand:Biosynth
    Description:Mesothelin antibody was raised using the middle region of MSLN corresponding to a region with amino acids QKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVL
    Notice:Our products are intended for lab use only. For any other use, please contact us.

    Chemical properties

    Inquiry about discontinued product: Mesothelin antibody

    ◻️
    CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
    * Mandatory fields.