TFF1 antibody
Ref. 3D-70R-6211
100µl
841.00€
Product Information
Name:TFF1 antibody
Brand:Biosynth
Description:TFF1 antibody was raised using the middle region of TFF1 corresponding to a region with amino acids PRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Purity:Min. 95%
Technical inquiry about: TFF1 antibody
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please add the desired products to your cart and manage the request from there. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.