PAP2D antibody
Ref. 3D-70R-6622
100µl
747.00€
Product Information
Name:PAP2D antibody
Brand:Biosynth
Description:PAP2D antibody was raised using the N terminal of PAP2D corresponding to a region with amino acids FTVNVQGFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGET
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Technical inquiry about: PAP2D antibody
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.