LOC729185 antibody
Ref. 3D-70R-6940
100µl
828.00€
Product Information
Name:LOC729185 antibody
Brand:Biosynth
Description:LOC729185 antibody was raised using the N terminal Of Loc729185 corresponding to a region with amino acids VSGDRRVRSRHAKVGTLGDREAILQRLDHLEEVVYNQLNGLAKPIGLVEG
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Purity:Min. 95%
Technical inquiry about: LOC729185 antibody
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.