CymitQuimica logo

ST6GALNAC4 antibody

Ref. 3D-70R-7277

100µl
Discontinued

Discontinued product. For inquiries about similar products, please fill out our form or email us at .

ST6GALNAC4 antibody
Biosynth

Product Information

Name:ST6GALNAC4 antibody
Brand:Biosynth
Description:ST6GALNAC4 antibody was raised using the middle region of ST6GALNAC4 corresponding to a region with amino acids QLTRMYPGLQVYTFTERMMAYCDQIFQDETGKNRRQSGSFLSTGWFTMIL
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Purity:Min. 95%

Inquiry about discontinued product: ST6GALNAC4 antibody

◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.