CymitQuimica logo

TMEM123 antibody

Ref. 3D-70R-7328

100µl
Discontinued

Discontinued product. For inquiries about similar products, please fill out our form or email us at .

TMEM123 antibody
Biosynth

Product Information

Name:TMEM123 antibody
Brand:Biosynth
Description:TMEM123 antibody was raised using the C terminal of TMEM123 corresponding to a region with amino acids SSVTITTTMHSEAKKGSKFDTGSFVGGIVLTLGVLSILYIGCKMYYSRRG
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Purity:Min. 95%

Inquiry about discontinued product: TMEM123 antibody

◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.