LL-37 acid

Ref. 3D-CRB1000007

Product Information

• Name: LL-37 acid
• Synonyms: H-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-OHhCAP18LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES-acidH-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-L ys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln -Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OHhCAP18
• Brand: Biosynth
• Description: LL-37, also known as CAP-18 for Cathelicidin antimicrobial peptide 18, is a 37 amino acid cationic peptide. LL-37 is also a typical linear antimicrobial peptide which can eliminate a wide range of pathogenes, including bacteria, viruses, fungi, and parasites. LL-37 is the only human cathelicidin peptide reported yet, found in lysosomes of macrophages and leukocytes.LL-37 plays an important role in the first act of defense against local infection and systemic invasion of pathogens at sites of inflammation.LL-37 shows cytotoxicity against bacterial and normal eukaryotic cells and is significantly resistant to proteolytic degradation. Besides its antimicrobial functions, LL-37 also has immunomodulatory roles. LL-37 suppresses the production of pro-inflammatory cytokines, TNF-α and IL-6 in infected monocytes. LL-37 increases cytokine and chemokine liberation from local cells and leucocytes and has chemotactic effects on a large number of immune cells.

Chemical properties

• Molecular weight: 4,490.6 g/mol