ACTH (1-39) Human
Ref. 3D-CRB1000076
| 1mg | 452.00 € | ||
| 500µg | 371.00 € |
Product Information
- H-SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-OHAdrenocorticotropic hormone (1-39)SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF-acidH-Ser-T yr-Ser-Met-Glu-His-P he-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-A sn-Gly-Ala-Glu-Asp-Glu-Ser-A
Human adrenocorticotropic hormone (ACTH) also known as corticotropin. ACTH is a tropic hormone produced and secreted by the anterior pituitary gland and member of the melanocortins peptide family. ACTH is cleaved from the precursor proopiomelanocortin (POMC). ACTH is an important component of the hypothalamic-pituitary-adrenal (HPA) axis and is often produced in response to biological stress. ACTH acts to increase the production and release of cortisol via its interaction with the ACTH receptor ACTHR, also known as melanocortin type 2 receptor (MC2R). Receptor activation increases the intracellular concentration of cAMP via adenylyl cyclase.Abnormal ACTH levels in the body has been linked to primary adrenal insufficiency/Addison's disease, Cushing's disease and secondary adrenal insufficiency
Chemical properties
Technical inquiry about: 3D-CRB1000076 ACTH (1-39) Human
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
