CymitQuimica logo

Amylin (1-37) Human

Ref. 3D-CRB1000269

500µg
470.00€
1mg
651.00€
Amylin (1-37) Human
Biosynth

Product Information

Name:Amylin (1-37) Human
Synonyms:
  • [Cyc(2,7)]H-KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-OHKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-acid
  • Disulphide bridge Cys2-Cys7H-Lys-C ys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-As
Brand:Biosynth
Description:Amylin, also known as islet amyloid polypeptide (IAPP), is a peptide hormone which is deficient in patients with diabetes mellitus (DM). Amylin is co-secreted with insulin from the pancreatic β-cells. It inhibits glucagon secretion, delays gastric emptying, and thus acts as a satiety agent.  Amylin peptide is capable of forming aggregates, and pancreatic amyloid plaques are present in 90% of patients with DM. Formation of these plaques may be inhibited by insulin via the formation of heteromolecular complexes. Amylin is also involved in adiposity signalling and body weight regulation.Amylin is expressed in the human placenta during pregnancy where it may help regulate food intake by both the mother and foetus, and is involved in foetal development of bone, kidneys and pancreas.
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Molecular weight:3,901.85 g/mol
Color/Form:Powder

Technical inquiry about: Amylin (1-37) Human

Please use instead the cart to request a quotation or an order

If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.