CymitQuimica logo

GIP (1-42)-[C] human

Ref. 3D-CRB1000509

1mg
Discontinued
100µg
Discontinued
500µg
Discontinued

Discontinued product. For inquiries about similar products, please fill out our form or email us at .

GIP (1-42)-[C] human
Biosynth

Product Information

Name:GIP (1-42)-[C] human
Synonyms:
  • H-YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQC-NH2
Brand:Biosynth
Description:Peptide derived from the Gastric inhibitory polypeptide (GIP), an inhibiting hormone of the secretin family of hormones. While GIP is a weak inhibitor of gastric acid secretion, its main role is to stimulate insulin secretion - in a glucose-dependent mechanism. Therefore, GIP is referred to as a glucose-dependent insulinotropic peptide.GIP is derived from a 153-amino acid pro-protein encoded by the GIP gene and circulates as a biologically active 42-amino acid peptide. It is synthesised by K cells, which are found in the mucosa of the duodenum and the jejunum of the gastrointestinal tract. GIP receptors are seven-transmembrane proteins found on β-cells in the pancreas. These β-cells are those that are able to simultaneously detect glucose and release insulin as a result to GIP binding.The clinical relevance of GIP is related to type 2 diabetes mellitus (T2DM)- studies have found that T2DM diabetics are unresponsive to GIP and have lower levels of GIP secretion after a meal when compared to non-diabetics. In research involving knockout mice, it was found that absence of the GIP receptors correlates with resistance to obesity.
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Molecular weight:1,234.5 g/mol

Inquiry about discontinued product: GIP (1-42)-[C] human

◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.