CymitQuimica logo

GLP-1 (1-37)

CAS:

Ref. 3D-CRB1001037

500µg
282.00€
1mg
470.00€
GLP-1 (1-37)
Biosynth

Product Information

Name:GLP-1 (1-37)
Synonyms:
  • H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OHHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-acidH-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr- Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly -Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OHgp VIP
Brand:Biosynth
Description:Glucagon-like peptide (GLP) 1 is a post-translationally modified version of proglucagon. GLP-1 (1-37) is a naturally produced analog of GLP-1. Unlike truncated GLP-1, GLP-1 (1-37) does not alter food intake in rat models or pancreatic insulin secretion. GLP-1 (1-37) can induce insulin production in developing adult intestinal cells via upregulation of the ngn3 gene and its downstream targets. This can restore glucose homeostasis when implanted into diabetic mice. GLP-1 (1-37) may offer a  future treatment for diabetes mellitus. GLP-1 (1-37) can also inhibit chemokine-induced migration of human CD4-positive lymphocytes, an early step in atherogenesis. This raises the possibility that GLP-1 (1-37) is part of a novel mechanism to modulate vascular disease.
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Molecular weight:4,169.54 g/mol

Technical inquiry about: GLP-1 (1-37)

Please use instead the cart to request a quotation or an order

If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.