Product Information
Name:Cecropin-B
Synonyms:
- H-KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala- Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Ly s-Ala-Leu-NH2CEF20
- Cytomegalovirus
- CMV pp65 (495-503)
Brand:Biosynth
Description:Cecropins are a lytic peptide family, originally isolated from Hyalophora cecropia. Cecropin-B is a cationic helical peptide that can form pores, this is believed to be the reason for its such potent lytic activity. Cecropin-B has been shown to be effective against both Gram-positive and Gram-negative bacteria plus numerous cancer cell lines including multidrug-resistant types. The ability to insert into the cell membrane and lead to pore formation is attributed to the amphipathic groups present creating amphipathic regions. The effectiveness of cecropin-B on cancer cells has led to further use of the peptide as a model for potential new anticancer drugs including cyclic cationic forms.
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Molecular weight:3,832.3 g/mol
Color/Form:Powder
Technical inquiry about: Cecropin-B
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.