gp96-II
Ref. 3D-CRB1001377
1mg | 271.00 € | ||
500µg | 198.00 € |
Product Information
- H-LNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY-OHLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADDKY-acidH-Leu-Asn-Val-Ser-Arg-Glu-Thr-Leu-Gln-Gln-His- Lys-Leu-Leu-Lys-Val-Ile-Arg-Lys-Lys-Leu-Va l-Arg-Lys-Thr-Leu-Asp-Met-Ile-Lys-Lys-Ile-Ala-Asp-Asp-Lys-Tyr-OH
Heat shock protein gp96 inhibitor which binds to and antagonizes gp96 mediated lipopolysaccharide (LPS) induced cytokine production. Anti-inflammatory in a number of in vivo and in vitro models.
Chemical properties
Technical inquiry about: 3D-CRB1001377 gp96-II
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.