
Ghrelin-[Cys(AF647)] Human
Ref. 3D-CRB1110382
1mg
490.00€
100µg
349.00€
500µg
477.00€

Product Information
Name:Ghrelin-[Cys(AF647)] Human
Synonyms:
- H-GSSFLSPEHQRVQQRKESKKPPAKLQPR(C/AF647)-NH2GSSFLSPEHQRVQQRKESKKPPAKLQPR-[Cys(AF647)]-amideH-Gly-Ser-Ser-Phe-Leu-Ser-Pro-Glu-His-Gl n-Arg-Val-Gln-Gln-Arg-Lys-Glu-Ser-Lys-Lys-Pr o-Pro-Ala-Lys-Leu-Gln-Pro-Arg-[Cys(AF647)]-NH2
Brand:Biosynth
Description:Ghrelin is a peptide hormone mainly produced in the stomach. Ghrelin is involved in several physiological processes, including feeding, lipid accumulation, stress response- anxiety- cardiac performance- immunity and inflammation, taste sensation, reward-seeking behaviour, glucose metabolism and thermogenesis, memory, motivation and learning.Ghrelin exerts its actions by binding the growth hormone secretagogue receptor (GHSR), mainly found in the hypothalamic and mesolimbic brain regions and peripheral organs (adipose tissue, adrenals, and stomach).Ghrelin is produced by the cleavage of the precursor peptide preproghrelin. The attachment of a fatty acid to its serine 3 residue makes a form capable of activating GHSR.Ghrelin is a valuable target for treating conditions such as anorexia, cachexia, sarcopenia, cardiopathy, neurodegenerative disorders, renal and pulmonary disease, gastrointestinal disorders, inflammatory disorders and metabolic syndrome.This ghrelin has a C-terminal AF647, a structural analog to Alexa Fluor 647, a widely used far-red fluorescent dye. Its excitation is ideally suited to 594nm or 633nm. This dye is suited for low abundance targets as it has high initial brightness and a high photostability allowing detection of low abundance peptides.
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Molecular weight:4,326.9 g/mol
Purity:Min. 95%
Technical inquiry about: Ghrelin-[Cys(AF647)] Human
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.