![Glucagon (1-29)-[Cys(Cy5)]](/_next/image/?url=https%3A%2Fstatic.cymitquimica.com%2Fproducts%2F3D%2Fthumb-webp%2FCRB1130431.webp&w=3840&q=75)
Glucagon (1-29)-[Cys(Cy5)]
Ref. 3D-CRB1130431
100µg
349.00€
500µg
477.00€
Product Information
Name:Glucagon (1-29)-[Cys(Cy5)]
Synonyms:
- H-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT(C/Cy5)-OHHSQGTFTSDYSKYLDSRRAQDFVQWLMNT-[Cys(Cy5)]-acidH-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Se r-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp- Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-[Cys(Cy5)]-OH
Brand:Biosynth
Description:Glucagon (1-29)-[Cys(Cy5)] is derived from glucagon, which is a peptide hormone secreted by alpha cells located in the islet of Langerhans region of the pancreas. Glucagon is an essential catabolic hormone that is responsible for the regulation of blood glucose levels. Once released into the bloodstream, glucagon stimulates the production of hepatic glucose, which means it is considered to be a glucose-mobilizing agent. Excessive levels of glucagon can result in the development of hyperglycaemia, since the action of glucagon results in abnormally high blood glucose levels.This peptide contains Cyanine 5 (Cy5), which is a widely used red fluorescent dye.
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Molecular weight:4,189 g/mol
Technical inquiry about: Glucagon (1-29)-[Cys(Cy5)]
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.