Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt

CAS: 1802086-24-3

Ref. 3D-FA109756

Product Information

• Name: Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt
• Synonyms: H-Ala-Ala-Val-Thr-Pro-Glu-Glu-Arg-His-Leu-Ser-Lys-Met-Gln-Gln-Asn-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH H- AAVTPEERHLSKMQQNGYENPTYKFFEQMQN-OH
• Brand: Biosynth

Description

Please enquire for more information about Amyloid beta/A4 Protein Precursor770 (740-770) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page

Chemical properties

• Molecular weight: 3,717.07 g/mol
• Formula: C₁₆₂H₂₄₃N₄₅O₅₂S₂
• Purity: Min. 95%