- Carboxylic Acids
- Enzyme, Peptide and Protein Related Compounds
- Amino Acids (AA)
- Peptides
- Organic Halides
- Biochemicals and Reagents
Product Information
Name:Amylin (mouse, rat) trifluoroacetate
Synonyms:
- H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Ar g-Ser-Ser-Asn-Asn- Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-G ly-Ser-Asn-Thr-Tyr-NH2 trifluoroacetate (disulfide bridge:Cys2-Cys7) H-KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 triflu
Brand:Biosynth
Description:Amylin (mouse, rat) trifluoroacetate is a synthetic peptide, which is a derivative of the islet amyloid polypeptide (IAPP) found in rodent species. It is sourced from the pancreatic beta cells of mice and rats, where it is co-secreted with insulin. The mode of action involves regulation of glucose metabolism through its effects on gastric emptying, glucagon secretion, and satiety. These actions are crucial in managing postprandial blood glucose levels and provide insights into the pathophysiology of diabetes.Amylin (mouse, rat) trifluoroacetate is primarily used in research applications to study the mechanisms of amylin aggregation and its implications in type 2 diabetes. It also serves as a model for understanding the differences in amyloid fibril formation between human and rodent amylin, making it invaluable for the development of therapeutic strategies aimed at mitigating amyloid-related cellular toxicity. Researchers utilize this peptide to explore the potential compensatory roles of amylin analogs in diabetic models, advancing our understanding of diabetes progression and treatment options.
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Molecular weight:3,920.4 g/mol
Formula:C167H272N52O53S2•(C2HF3O2)x
Purity:Min. 95%
Technical inquiry about: Amylin (mouse, rat) trifluoroacetate
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please add the desired products to your cart and manage the request from there. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
