Amylin (mouse, rat) trifluoroacetate

CAS: 124447-81-0

Ref. 3D-FA110436

Product Information

• Name: Amylin (mouse, rat) trifluoroacetate
• Synonyms: H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-Ar g-Ser-Ser-Asn-Asn- Leu-Gly-Pro-Val-Leu-Pro-Pro-Thr-Asn-Val-G ly-Ser-Asn-Thr-Tyr-NH2 trifluoroacetate (disulfide bridge:Cys2-Cys7) H-KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 triflu
• Brand: Biosynth
• Description: Amylin (mouse, rat) trifluoroacetate is a synthetic peptide, which is a derivative of the islet amyloid polypeptide (IAPP) found in rodent species. It is sourced from the pancreatic beta cells of mice and rats, where it is co-secreted with insulin. The mode of action involves regulation of glucose metabolism through its effects on gastric emptying, glucagon secretion, and satiety. These actions are crucial in managing postprandial blood glucose levels and provide insights into the pathophysiology of diabetes.Amylin (mouse, rat) trifluoroacetate is primarily used in research applications to study the mechanisms of amylin aggregation and its implications in type 2 diabetes. It also serves as a model for understanding the differences in amyloid fibril formation between human and rodent amylin, making it invaluable for the development of therapeutic strategies aimed at mitigating amyloid-related cellular toxicity. Researchers utilize this peptide to explore the potential compensatory roles of amylin analogs in diabetic models, advancing our understanding of diabetes progression and treatment options.

Chemical properties

• Molecular weight: 3,920.4 g/mol
• Formula: C₁₆₇H₂₇₂N₅₂O₅₃S₂•(C₂HF₃O₂)x
• Purity: Min. 95%