Cys-Gly-Lys-Arg-Amyloid b-Protein (1-42)
CAS: 1802086-21-0
Ref. 3D-FC109823
1mg | 774.00 € | ||
2mg | 1,243.00 € | ||
5mg | 2,731.00 € | ||
250µg | 322.00 € | ||
500µg | 472.00 € |
Product Information
- H-Cys-Gly-Lys-Arg-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gl y-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH H-CGKRDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH
Please enquire for more information about Cys-Gly-Lys-Arg-Amyloid b-Protein (1-42) including the price, delivery time and more detailed product information at the technical inquiry form on this page
Chemical properties
Technical inquiry about: 3D-FC109823 Cys-Gly-Lys-Arg-Amyloid b-Protein (1-42)
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.