- Carboxylic Acids
- Enzyme, Peptide and Protein Related Compounds
- Amino Acids (AA)
- Peptides
- Biochemicals and Reagents
Product Information
Name:GRF (human) acetate salt
Synonyms:
- Somatorelin, Growth Hormone-Releasing Factor (human), Growth Hormone-Releasing Hormone (human), GHRH (human), Somatoliberin (human), Somatocrinin (human), GHRF (1-44), human
Brand:Biosynth
Description:Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine: H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine: H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Molecular weight:5,039.65 g/mol
Formula:C215H358N72O66S
Purity:Min. 98 Area-%
Color/Form:Powder
Technical inquiry about: GRF (human) acetate salt
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
