(Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
CAS: 215777-46-1
Ref. 3D-FS109310
1mg | 922.00 € | ||
2mg | 1,478.00 € | ||
5mg | 3,213.00 € | ||
250µg | 359.00 € | ||
500µg | 556.00 € |
Product Information
- H-His-Ser-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2 H-HSE GTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
- 7-36-Glucagon-likepeptide 1 (Octodon degus), 8-L-serine-36-L-argininamide- (9CI)
- L-Argininamide, L-histidyl-L-seryl-L-a-glutamylglycyl-L-threonyl-L-phenylalanyl-L-threonyl-L-seryl-L-a-aspartyl-L-valyl-L-seryl-L-seryl-L-tyrosyl-L-leucyl-L-a-glutamylglycyl-L-glutaminyl-L-alanyl-L-alanyl-L-lysyl-L-a-glutamyl-L-phenylalanyl-L-isoleucyl-L-alanyl-L-tryptophyl-L-leucyl-L-valyl-L-lysylglycyl-
- (Ser79)-Proglucagon (78-107) Amide (Human, Bovine, Guinea Pig, Mouse, Rat) Trifluoroacetate Salt
- 22: PN:WO0155213 SEQID: 22 claimed sequence
Please enquire for more information about (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page
Chemical properties
Technical inquiry about: 3D-FS109310 (Ser8)-GLP-1 (7-36) amide (human, bovine, guinea pig, mouse, rat) trifluoroacetate salt
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.