CymitQuimica logo

β-Defensin-3 (Human)

Ref. 3D-PDF-4382-S

100µg
986.00€
β-Defensin-3 (Human)
Biosynth

Product Information

Name:β-Defensin-3 (Human)
Synonyms:
  • hBD-3Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly- Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly- Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-LysDEFB3GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKC
Brand:Biosynth
Description:β-Defensin-3 is a human peptide that belongs to the class of defensins. β-Defensin-3 is a potent activator of ion channels, and has been shown to be an inhibitor of ligand binding. β-Defensin-3 is also known to have antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus. This protein interacts with receptors, such as TNF receptor 1, and can be used as a research tool for studying protein interactions. β-Defensin 3 has been shown to inhibit the growth of tumor cells in vitro by interacting with the intracellular proteins, phosphatidylserine (PS) and annexin A2, which are involved in apoptosis.
Notice:Our products are intended for lab use only. For any other use, please contact us.

Chemical properties

Molecular weight:5,155.1 g/mol
Formula:C216H371N75O59S6
Purity:Min. 95%

Technical inquiry about: β-Defensin-3 (Human)

Please use instead the cart to request a quotation or an order

If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
◻️
CYMIT QUÍMICA, S.L. as responsible for the treatment will treat your data in order to respond to your queries or requests. You can access, rectify and delete your data, as well as exercise other rights by consulting the additional and detailed information on data protection in our Web Privacy Policy.
* Mandatory fields.