
β-Defensin-3 (Human)
Ref. 3D-PDF-4382-S
100µg
1,030.00€

Product Information
Name:β-Defensin-3 (Human)
Synonyms:
- hBD-3Gly-Ile-Ile-Asn-Thr-Leu-Gln-Lys-Tyr-Tyr-Cys-Arg-Val-Arg-Gly-Gly- Arg-Cys-Ala-Val-Leu-Ser-Cys-Leu-Pro-Lys-Glu-Glu-Gln-Ile-Gly- Lys-Cys-Ser-Thr-Arg-Gly-Arg-Lys-Cys-Cys-Arg-Arg-Lys-LysDEFB3GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKC
Brand:Biosynth
Description:β-Defensin-3 is a human peptide that belongs to the class of defensins. β-Defensin-3 is a potent activator of ion channels, and has been shown to be an inhibitor of ligand binding. β-Defensin-3 is also known to have antibacterial activity against Gram-positive bacteria such as Staphylococcus aureus. This protein interacts with receptors, such as TNF receptor 1, and can be used as a research tool for studying protein interactions. β-Defensin 3 has been shown to inhibit the growth of tumor cells in vitro by interacting with the intracellular proteins, phosphatidylserine (PS) and annexin A2, which are involved in apoptosis.
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Molecular weight:5,155.1 g/mol
Formula:C216H371N75O59S6
Purity:Min. 95%
Technical inquiry about: β-Defensin-3 (Human)
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.