Product Information
Name:Exendin 4
Synonyms:
- H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPP
Brand:Biosynth
Description:Custom research peptide; min purity 95%.
Notice:Our products are intended for lab use only. For any other use, please contact us.
Chemical properties
Molecular weight:4,186.03 g/mol
Formula:C184H282N50O60S1
Purity:Min. 95%
Technical inquiry about: Exendin 4
Please use instead the cart to request a quotation or an order
If you want to request a quotation or place an order, please instead add the desired products to your cart and then request a quotation or order from the cart. It is faster, cheaper, and you will be able to benefit from the available discounts and other advantages.
